LOCUS AL590887 820 bp mRNA linear HUM 15-OCT-2008
DEFINITION Novel human CDS from chromosome 22, splice variant of Homo sapiens
gamma-parvin (PARVG) mRNA (AF237772).
ACCESSION AL590887
VERSION AL590887.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 820)
AUTHORS Goward M.E., Huckle E.J.
JOURNAL Submitted (24-APR-2001) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the bacterial clone 671O14 (AL031595).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
FEATURES Location/Qualifiers
source 1..820
/db_xref="H-InvDB:HIT000250639"
/organism="Homo sapiens"
/chromosome="22"
/mol_type="mRNA"
/tissue_type="Fetal brain"
/db_xref="taxon:9606"
exon 1..79
/number=1
misc_feature 1..203
/note="matches EST AA309454"
misc_feature 1..55
/note="matches EST AA280188 from clone IMAGE:712107"
misc_feature 1..79
/note="matches EST AW968901"
/note="matches EST AA488785 from clone IMAGE:824741"
CDS 1..>820
/product="hypothetical protein"
/db_xref="GOA:Q9HBI0"
/db_xref="H-InvDB:HIT000250639.11"
/db_xref="HGNC:HGNC:14654"
/db_xref="InterPro:IPR001715"
/db_xref="InterPro:IPR028433"
/db_xref="InterPro:IPR036872"
/db_xref="UniProtKB/Swiss-Prot:Q9HBI0"
/protein_id="CAC37414.1"
/translation="MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFE
ELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQ
KHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNV
QVEVITIESTKSGLKSEKLVEQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVN
FVNQKLDRLGLSVQNLDTQFADGVILLLLIGQLEGFFLHLKEFYLTPNSPAEMIS"
misc_feature join(31..301,300..317,323..345)
/note="matches EST AA354389"
misc_feature 32..394
/note="matches EST AW962090"
exon 80..144
/number=2
exon 145..247
/number=3
misc_feature 145..250
/note="matches EST H55730 from clone C22_930"
misc_feature 198..478
/note="matches EST BF902114"
exon 248..388
/number=4
misc_feature 336..626
/note="matches EST AA310427"
misc_feature complement(353..732)
/note="matches EST BF901077"
misc_feature join(370..451,448..806)
/note="matches EST AW380333"
misc_feature join(372..435,433..687)
/note="matches EST BE149733"
exon 389..504
/number=5
misc_feature 391..560
/note="matches EST H55711 from clone C22_898"
misc_feature join(391..477,504..560)
/note="matches EST H55713 from clone C22_901"
misc_feature 403..629
/note="matches EST BF379083"
misc_feature join(439..709,707..749)
/note="matches EST BE149705"
misc_feature complement(461..815)
/note="matches EST BF925182"
/note="matches EST BF925897"
exon 505..560
/number=6
misc_feature complement(510..542)
/note="matches EST AW811086"
misc_feature complement(join(524..652,653..746,743..815))
/note="matches EST BF925835"
misc_feature 544..815
/note="matches EST AV761537 from clone MDSAJF01"
exon 561..583
/number=7
misc_feature join(561..638,638..711)
/note="matches EST H55275 from clone C22_267"
misc_feature join(564..596,592..815)
/note="matches EST BF892477"
misc_feature complement(578..815)
/note="matches EST BF925908"
/note="matches EST BF894249"
/note="matches EST BF925889"
exon 584..642
/number=8
misc_feature complement(623..815)
/note="matches EST AW378128"
exon 643..711
/number=9
misc_feature join(656..713,713..815)
/note="matches EST AW834825"
misc_feature complement(665..815)
/note="matches EST AI540087 from clone IMAGE:2075127"
misc_feature complement(684..815)
/note="matches EST BF515947 from clone IMAGE:3084071"
misc_feature complement(711..815)
/note="matches EST BF892473"
exon 712..813
/number=10
misc_feature 712..813
/note="matches EST H55366 from clone C22_382"
misc_feature 738..815
/note="matches EST BF895417"
misc_feature 753..815
/note="matches EST AW385311"
exon 814..820
/number=11
BASE COUNT 209 a 225 c 226 g 160 t
ORIGIN
1 atggagccgg agttcttgta cgacctgctg cagctcccca agggggtgga gcccccagcg
61 gaggaggagc tctcaaaagg aggaaagaag aaatacctgc cacccacttc ccggaaggac
121 cccaaatttg aagaactgca gaaggtgttg atggagtgga tcaatgccac tcttctcccc
181 gagcacattg tggtccgcag cctggaggag gacatgttcg acgggctcat cctacaccac
241 ctattccaga ggctggcggc gctcaagctg gaagcagagg acatcgccct gacagccaca
301 agccagaagc acaagctcac agtggtgctg gaggccgtga accggagtct gcagctggag
361 gagtggcagg ccaagtggag cgtggagagc atcttcaaca aggacctgtt gtctaccctg
421 cacctccttg tggccctggc caagcgcttc cagcccgacc tctccctccc aaccaacgtc
481 caggtggagg tcatcactat cgagagcacc aaaagtggtc tgaagtcaga gaagttggtg
541 gaacagctca ctgaatacag cacagacaag gacgagcctc caaaggacgt ctttgatgaa
601 ttatttaagc tggctccgga gaaagtgaac gcagtgaaag aggccatcgt gaactttgtc
661 aaccagaagc tggaccgcct gggcctgtct gtgcagaatc tggacaccca gtttgcagat
721 ggggtcatct tactcttgct gattggacaa cttgaaggct tcttcctgca cttaaaggaa
781 ttctacctca ctcccaactc tcctgcagaa atgatatcgt
//