LOCUS       AL590119                 781 bp    mRNA    linear   HUM 15-OCT-2008
DEFINITION  Novel human mRNA from chromosome 22. Splice variant of SULTX3.
ACCESSION   AL590119
VERSION     AL590119.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 781)
  AUTHORS   Goward M.E., Huckle E.J.
  JOURNAL   Submitted (12-MAR-2001) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 388M5 (Z97055).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr22/
            Sanger Centre name : SULTX3
FEATURES             Location/Qualifiers
     source          1..781
                     /db_xref="H-InvDB:HIT000250634"
                     /organism="Homo sapiens"
                     /chromosome="22"
                     /mol_type="mRNA"
                     /tissue_type="Testis"
                     /db_xref="taxon:9606"
     exon            1..169
                     /number=1
     misc_feature    join(1..173,300..440,442..627,629..690,691..715)
                     /note="matches EST BF313539 from clone IMAGE:4129358"
     CDS             1..>781
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9BR01"
                     /db_xref="H-InvDB:HIT000250634.11"
                     /db_xref="HGNC:HGNC:14903"
                     /db_xref="InterPro:IPR000863"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="PDB:1ZD1"
                     /db_xref="UniProtKB/Swiss-Prot:Q9BR01"
                     /protein_id="CAC34872.1"
                     /translation="MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVR
                     PSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKEL
                     TSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQE
                     FCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSC
                     DKAQLEALTEHCHQLVDQCCNAEALPVGRAHCVFARKIFLSW"
     exon            170..300
                     /number=2
     misc_feature    271..608
                     /note="matches EST AA351518"
     exon            301..381
                     /number=3
     exon            382..508
                     /number=4
     exon            509..603
                     /number=5
     exon            604..742
                     /number=6
     misc_feature    complement(656..744)
                     /note="matches EST BE703427"
     exon            743..781
                     /number=7
BASE COUNT          152 a          233 c          236 g          160 t
ORIGIN      
        1 atggcggaga gcgaggccga gacccccagc accccggggg agttcgagag caagtacttc
       61 gagttccatg gcgtgcggct gccgcccttc tgccgcggga agatggagga gatcgccaac
      121 ttcccggtgc ggcccagcga cgtgtggatc gtcacctacc ccaagtccgg caccagcttg
      181 ctgcaggagg tggtctactt ggtgagccag ggcgctgacc ccgatgagat cggcttgatg
      241 aacatcgacg agcagctccc ggtcctggag tacccacagc cgggcctgga catcatcaag
      301 gaactgacct ctccccgcct catcaagagc cacctgccct accgctttct gccctctgac
      361 ctccacaatg gagactccaa ggtcatctat atggctcgca accccaagga tctggtggtg
      421 tcttattatc agttccaccg ctctctgcgg accatgagct accgaggcac ctttcaagaa
      481 ttctgccgga ggtttatgaa tgataagctg ggctacggct cctggtttga gcacgtgcag
      541 gagttctggg agcaccgcat ggactcgaac gtgctttttc tcaagtatga agacatgcat
      601 cgggacctgg tgacgatggt ggagcagctg gccagattcc tgggggtgtc ctgtgacaag
      661 gcccagctgg aagccctgac ggagcactgc caccagctgg tggaccagtg ctgcaacgct
      721 gaggccctgc ccgtgggccg ggcacattgc gtctttgctc ggaagatctt cttgagttgg
      781 t
//