LOCUS AL590119 781 bp mRNA linear HUM 15-OCT-2008 DEFINITION Novel human mRNA from chromosome 22. Splice variant of SULTX3. ACCESSION AL590119 VERSION AL590119.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 781) AUTHORS Goward M.E., Huckle E.J. JOURNAL Submitted (12-MAR-2001) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 388M5 (Z97055). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr22/ Sanger Centre name : SULTX3 FEATURES Location/Qualifiers source 1..781 /db_xref="H-InvDB:HIT000250634" /organism="Homo sapiens" /chromosome="22" /mol_type="mRNA" /tissue_type="Testis" /db_xref="taxon:9606" exon 1..169 /number=1 misc_feature join(1..173,300..440,442..627,629..690,691..715) /note="matches EST BF313539 from clone IMAGE:4129358" CDS 1..>781 /product="hypothetical protein" /db_xref="GOA:Q9BR01" /db_xref="H-InvDB:HIT000250634.11" /db_xref="HGNC:HGNC:14903" /db_xref="InterPro:IPR000863" /db_xref="InterPro:IPR027417" /db_xref="PDB:1ZD1" /db_xref="UniProtKB/Swiss-Prot:Q9BR01" /protein_id="CAC34872.1" /translation="MAESEAETPSTPGEFESKYFEFHGVRLPPFCRGKMEEIANFPVR PSDVWIVTYPKSGTSLLQEVVYLVSQGADPDEIGLMNIDEQLPVLEYPQPGLDIIKEL TSPRLIKSHLPYRFLPSDLHNGDSKVIYMARNPKDLVVSYYQFHRSLRTMSYRGTFQE FCRRFMNDKLGYGSWFEHVQEFWEHRMDSNVLFLKYEDMHRDLVTMVEQLARFLGVSC DKAQLEALTEHCHQLVDQCCNAEALPVGRAHCVFARKIFLSW" exon 170..300 /number=2 misc_feature 271..608 /note="matches EST AA351518" exon 301..381 /number=3 exon 382..508 /number=4 exon 509..603 /number=5 exon 604..742 /number=6 misc_feature complement(656..744) /note="matches EST BE703427" exon 743..781 /number=7 BASE COUNT 152 a 233 c 236 g 160 t ORIGIN 1 atggcggaga gcgaggccga gacccccagc accccggggg agttcgagag caagtacttc 61 gagttccatg gcgtgcggct gccgcccttc tgccgcggga agatggagga gatcgccaac 121 ttcccggtgc ggcccagcga cgtgtggatc gtcacctacc ccaagtccgg caccagcttg 181 ctgcaggagg tggtctactt ggtgagccag ggcgctgacc ccgatgagat cggcttgatg 241 aacatcgacg agcagctccc ggtcctggag tacccacagc cgggcctgga catcatcaag 301 gaactgacct ctccccgcct catcaagagc cacctgccct accgctttct gccctctgac 361 ctccacaatg gagactccaa ggtcatctat atggctcgca accccaagga tctggtggtg 421 tcttattatc agttccaccg ctctctgcgg accatgagct accgaggcac ctttcaagaa 481 ttctgccgga ggtttatgaa tgataagctg ggctacggct cctggtttga gcacgtgcag 541 gagttctggg agcaccgcat ggactcgaac gtgctttttc tcaagtatga agacatgcat 601 cgggacctgg tgacgatggt ggagcagctg gccagattcc tgggggtgtc ctgtgacaag 661 gcccagctgg aagccctgac ggagcactgc caccagctgg tggaccagtg ctgcaacgct 721 gaggccctgc ccgtgggccg ggcacattgc gtctttgctc ggaagatctt cttgagttgg 781 t //