LOCUS AL449244 2315 bp mRNA linear HUM 15-OCT-2008
DEFINITION Novel human gene mapping to chomosome 22.
ACCESSION AL449244
VERSION AL449244.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2315)
AUTHORS Collins J.E., Huckle E.J.
JOURNAL Submitted (02-NOV-2000) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the bacterial clone 402G11 (AL022328).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
FEATURES Location/Qualifiers
source 1..2315
/db_xref="H-InvDB:HIT000250629"
/organism="Homo sapiens"
/chromosome="22"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..71
/number=1
misc_feature 1..492
/note="matches EST AW630084 from clone IMAGE:2968884"
misc_feature join(5..25,83..108,109..161,275..307,304..360,361..408,
418..459,459..486)
/note="matches EST BE268804 from clone IMAGE:3143186"
misc_feature join(23..72,62..342)
/note="matches EST BE247595 from clone TCBAP4362"
misc_feature 33..587
/note="matches EST BE296637 from clone IMAGE:3528929"
misc_feature 56..639
/note="matches EST BE019403 from clone IMAGE:3010149"
exon 72..138
/number=2
misc_feature 72..332
/note="matches EST BE241782 from clone TCAAP0276"
misc_feature join(72..185,189..253,254..546,566..621)
/note="matches EST BE779390 from clone IMAGE:3867360"
CDS 106..1236
/product="hypothetical protein"
/db_xref="H-InvDB:HIT000250629.14"
/db_xref="HGNC:HGNC:28805"
/db_xref="InterPro:IPR002816"
/db_xref="UniProtKB/Swiss-Prot:Q9H4I3"
/protein_id="CAC15001.1"
/translation="MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFN
LLLEMKLKRRRQRPNLPRTVTQLVAEDGSRVYVVGTAHFSDDSKRDVVKTIREVQPDV
VVVELCQYRVSMLKMDESTLLREAQELSLEKLQQAVRQNGLMSGLMQMLLLKVSAHIT
EQLGMAPGGEFREAFKEASKVPFCKFHLGDRPIPVTFKRAIAALSFWQKVRLAWGLCF
LSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTYMLRQAARRLEL
PRASDAEPRKCVPSVVVGVVGMGHVPGIEKNWSTDLNIQEIMTVPPPSVSGRVSRLAV
KAAFFGLLGYSLYWMGRRTASLVLSLPAAQYCLQRVTEARHK"
misc_feature join(117..189,185..306,305..377,378..830)
/note="matches EST BE903494 from clone IMAGE:3959423"
misc_feature join(126..161,181..222,223..254,316..333,339..432,
437..531,526..565)
/note="matches EST BE297217 from clone IMAGE:3532746"
misc_feature join(133..161,178..260,259..328,326..751)
/note="matches EST BE733100 from clone IMAGE:3839887"
exon 139..217
/number=3
misc_feature join(139..189,185..830,829..850,848..884,886..909)
/note="matches EST BE732755 from clone IMAGE:3840199"
misc_feature join(139..189,185..282,276..604,601..686,804..832,
834..855,867..884)
/note="matches EST BE732219 from clone IMAGE:3842797"
misc_feature join(139..180,385..473)
/note="matches EST H55661 from clone C22_819"
exon 218..384
/number=4
misc_feature join(316..629,620..705,701..726)
/note="matches EST BF035118 from clone IMAGE:3857552"
misc_feature 327..807
/note="matches EST BE392828 from clone IMAGE:3626049"
misc_feature complement(join(376..525,1269..1425))
/note="matches EST AW296274 from clone IMAGE:2728679"
exon 385..525
/number=5
misc_feature join(477..522,524..603,604..800)
/note="matches EST AA484955 from clone IMAGE:815811"
misc_feature complement(join(516..812,2184..2312))
/note="matches EST AW207083 from clone IMAGE:2721029"
misc_feature complement(join(522..812,2184..2312))
/note="matches EST AW139687 from clone IMAGE:2717767"
misc_feature complement(522..634)
/note="matches EST AL119220 from clone DKFZp761A1513"
exon 526..636
/number=6
exon 637..776
/number=7
misc_feature complement(join(658..682,710..793))
/note="matches EST AW581613"
misc_feature 680..1345
/note="matches EST BE798997 from clone IMAGE:3937425"
misc_feature complement(join(701..953,949..1069,1066..1104))
/note="matches EST AW391908"
misc_feature 710..750
/note="matches EST H38489 from clone IMAGE:192703"
misc_feature join(710..781,774..797,797..842)
/note="matches EST R87853 from clone IMAGE:180877"
misc_feature 710..781
/note="matches EST R90897 from clone IMAGE:167195"
/note="matches EST H52024 from clone IMAGE:180775"
misc_feature 716..781
/note="matches EST R88865 from clone IMAGE:166786"
misc_feature 722..1337
/note="matches EST BE790098 from clone IMAGE:3885312"
exon 777..949
/number=8
misc_feature complement(781..1428)
/note="matches EST AI922958 from clone IMAGE:2450441"
/note="matches EST BF056056 from clone IMAGE:3393294"
misc_feature complement(844..1425)
/note="matches EST AI972432 from clone IMAGE:2490087"
misc_feature 922..1290
/note="matches EST BF037039 from clone IMAGE:3860593"
exon 950..1061
/number=9
misc_feature complement(962..1428)
/note="matches EST AI922949 from clone IMAGE:2450442"
misc_feature complement(join(970..1036,1034..1425))
/note="matches EST AI961967 from clone IMAGE:2509971"
misc_feature complement(970..1428)
/note="matches EST BE205784 from clone IMAGE:3009950"
misc_feature complement(join(975..1132,1132..1158,1153..1424))
/note="matches EST AA568658 from clone IMAGE:1057633"
misc_feature complement(1043..1425)
/note="matches EST AW614802 from clone IMAGE:2957737"
misc_feature complement(join(1060..1132,1132..1151))
/note="matches EST R87761 from clone IMAGE:180853"
/note="matches EST R87771 from clone IMAGE:180877"
misc_feature complement(1060..1151)
/note="matches EST H38451 from clone IMAGE:192703"
misc_feature complement(join(1060..1151,1438..1512))
/note="matches EST H52133 from clone IMAGE:180775"
exon 1062..2315
/number=10
misc_feature join(1146..1198,1200..1356)
/note="matches EST BE019143 from clone IMAGE:3009950"
misc_feature complement(1200..1428)
/note="matches EST AW294860 from clone IMAGE:2727036"
misc_feature complement(join(1312..1622,2177..2312))
/note="matches EST AW009248 from clone IMAGE:2504220"
misc_feature complement(1324..1425)
/note="matches EST AW195438 from clone IMAGE:2695969"
misc_feature complement(1367..1424)
/note="matches EST AA627381 from clone IMAGE:1147182"
misc_feature 1405..1642
/note="matches EST H43455 from clone IMAGE:182675"
misc_feature complement(join(1475..1541,1543..1719,1717..1880))
/note="matches EST AA744612 from clone IMAGE:1283163"
misc_feature 1541..1584
/note="matches EST H61275 from clone IMAGE:236279"
misc_feature complement(join(1565..1664,1652..2211,2210..2240,
2241..2266))
/note="matches EST BE620712 from clone IMAGE:3886163"
misc_feature complement(join(1584..1699,1700..1938,2161..2310))
/note="matches EST AI472172 from clone IMAGE:2148401"
misc_feature 1616..1656
/note="matches EST H18285 from clone IMAGE:171700"
misc_feature complement(join(1766..1950,2164..2289))
/note="matches EST H61279 from clone IMAGE:236298"
misc_feature complement(join(1776..1838,1849..2010))
/note="matches EST W79111 from clone IMAGE:346870"
misc_feature 1789..2009
/note="matches EST AA937290 from clone IMAGE:1541211"
misc_feature 1792..2047
/note="matches EST AI565630 from clone IMAGE:2169487"
misc_feature 1798..2255
/note="matches EST BE670494 from clone IMAGE:3285664"
misc_feature join(1801..2077,2076..2203)
/note="matches EST AA977234 from clone IMAGE:1558798"
misc_feature 1805..2047
/note="matches EST AI262444 from clone IMAGE:1871302"
misc_feature 1805..2093
/note="matches EST AI028355 from clone IMAGE:1645185"
misc_feature join(1808..1911,2183..2290)
/note="matches EST AW241755 from clone IMAGE:2700229"
misc_feature 1809..2259
/note="matches EST AI830402 from clone IMAGE:2388386"
misc_feature 1809..2226
/note="matches EST AI863406 from clone IMAGE:2291089"
misc_feature 1811..2047
/note="matches EST AI627911 from clone IMAGE:2279645"
misc_feature complement(join(1816..1842,2080..2158))
/note="matches EST BE964968 from clone IMAGE:3886163"
misc_feature 1816..2047
/note="matches EST BE885779 from clone IMAGE:3910438"
misc_feature complement(1817..2315)
/note="matches EST BE205924 from clone IMAGE:3010149"
misc_feature complement(1817..2308)
/note="matches EST AA588141 from clone IMAGE:1076329"
misc_feature join(1836..2010,2076..2139)
/note="matches EST T77226 from clone IMAGE:113833"
misc_feature complement(1845..2315)
/note="matches EST AA814773 from clone IMAGE:1334062"
misc_feature complement(join(1861..2182,2177..2315))
/note="matches EST AI160191 from clone IMAGE:1705210"
misc_feature complement(1862..2312)
/note="matches EST AI201980 from clone IMAGE:1944119"
misc_feature complement(join(1865..2136,2124..2311))
/note="matches EST AI925162 from clone IMAGE:2444084"
misc_feature complement(join(1865..2182,2177..2315))
/note="matches EST AI127380 from clone IMAGE:1705469"
misc_feature complement(1869..2312)
/note="matches EST AI342611 from clone IMAGE:1949391"
misc_feature complement(join(1884..1933,1931..2311))
/note="matches EST AW083411 from clone IMAGE:2583143"
misc_feature complement(1896..2312)
/note="matches EST AA805194 from clone IMAGE:1319479"
misc_feature complement(1899..2312)
/note="matches EST AI439834 from clone IMAGE:2140331"
misc_feature complement(1915..2312)
/note="matches EST AA689445 from clone IMAGE:1183894"
misc_feature complement(1937..2310)
/note="matches EST AI357020 from clone IMAGE:2002029"
misc_feature complement(1939..2309)
/note="matches EST AW079361 from clone IMAGE:2584411"
misc_feature complement(join(1954..2009,2098..2315))
/note="matches EST AA737056 from clone IMAGE:1270082"
misc_feature complement(join(1958..2077,2076..2312))
/note="matches EST AA805139 from clone IMAGE:1339517"
misc_feature complement(join(1968..2101,2094..2312))
/note="matches EST AA932425 from clone IMAGE:1571976"
misc_feature complement(1974..2207)
/note="matches EST H40914 from clone IMAGE:177052"
misc_feature complement(join(1979..2001,2164..2315))
/note="matches EST W79775 from clone IMAGE:346870"
misc_feature complement(1983..2312)
/note="matches EST AI202760 from clone IMAGE:1859431"
misc_feature complement(1997..2312)
/note="matches EST AI610198 from clone IMAGE:2187843"
misc_feature complement(2004..2311)
/note="matches EST AA706036 from clone IMAGE:379798"
misc_feature complement(2004..2315)
/note="matches EST AA811430 from clone IMAGE:1337572"
misc_feature 2045..2271
/note="matches EST T24778 from clone 13C4"
misc_feature complement(2090..2312)
/note="matches EST AA029368 from clone IMAGE:470368"
misc_feature complement(2098..2312)
/note="matches EST AA996274 from clone IMAGE:1604067"
/note="matches EST AA730183 from clone IMAGE:1258628"
misc_feature complement(2099..2315)
/note="matches EST AA865363 from clone IMAGE:1469968"
/note="matches EST T77439 from clone IMAGE:113833"
BASE COUNT 404 a 755 c 741 g 415 t
ORIGIN
1 ccgcgccgca tggaggccgg ctgaggagcg ccgctgcctc gcctcggtac gccgcgcggc
61 gcggacggcg cgctccccac aggtgcagga agccgccgcc cagccatgga cggggaggag
121 cagcagccac cgcacgaggc caacgtggaa cctgttgtgc cgtcagaggc ttcagagccg
181 gtgcccaggg tgctttctgg agacccccag aacctgtccg acgtggacgc cttcaacctg
241 ctcctggaga tgaagctgaa gcggcggcgt cagcggccca acctgccgcg cactgtgacc
301 cagttggtgg ctgaggacgg gagcagggtg tacgtggtgg ggacagccca cttcagcgac
361 gacagcaaga gggacgttgt gaagaccatc cgggaggtgc agcctgacgt ggtggtcgtg
421 gagctctgcc aatatcgtgt gtccatgctg aagatggacg agagcacgct gctgcgggag
481 gcccaggagc tcagcctgga gaagctgcag caggccgtga ggcagaacgg gctcatgtcg
541 gggctgatgc agatgctgct gctgaaggtg tctgcacaca tcaccgagca gctgggcatg
601 gccccaggtg gcgagttcag ggaggccttc aaggaggcca gcaaggtgcc tttctgcaag
661 ttccacctgg gtgaccgacc catccccgtc accttcaaga gggccatcgc agcgctctcc
721 ttctggcaga aggtcaggct ggcttggggc ctgtgcttcc tgtcagaccc catcagcaag
781 gatgacgtgg aacgctgcaa gcagaaggac ctactggagc agatgatggc cgagatgatt
841 ggcgagttcc cagacctgca ccgcaccatc gtctcggagc gcgacgtcta cctaacctac
901 atgctgcgcc aggccgcgcg gcgcctcgag ctgcctcggg cctctgacgc cgagcccagg
961 aagtgcgtcc cctccgtggt cgtgggcgtc gtgggcatgg gccacgtgcc tggcatcgag
1021 aagaactgga gcaccgacct caacatccag gagatcatga ccgtgccccc gccgtccgtc
1081 tccggcagag tgtctcggtt ggccgtgaag gccgccttct tcggcctgct gggctacagc
1141 ctgtactgga tgggccgccg caccgcgagc ctggtcctgt cgctgcccgc cgcgcagtac
1201 tgcctgcaga gggtgaccga ggcccggcac aagtaggaga ctgctccccg cccgctcggg
1261 cccctgagga gccagtgccc ccgcggcact tctgggtgcc aggtgcatcc tagcccgccc
1321 gaggcccctg ccacccccca tgggggtctg ggcccggcct cgcctgccct cctgggccag
1381 tcacccctcc cccagcccac ccaaataaag gattatttaa ctgtctgagc tcaggcctcc
1441 cggcagcccc tcccctccca cactgcaggg gccgttcccc agcttctgga caagacaccc
1501 agctccgagg gggcaggggc ttataggagg ggccgaggcg tgcgctgccc tctcagccct
1561 ggtggcaggc gggggacaat ggccactgtc cctacctcac tgtgccttcc tgtgctccgg
1621 ccacaggagc gtcggcccag gggcggctcc tgggggctcc agggcaggcg agactgggaa
1681 aggcccagcc ctggagctcc agccgacccc accgtgcccc tggcatcctg gccctggccg
1741 ccacctccct ggcaccgtct gcctgcaggg attctgtgtt tttggctttt ttaatgtctt
1801 aaaatctttt actcaggtaa ttttaatttc agagagaaaa actgaagtaa atgtcaaaaa
1861 acaccagcct taaatccaaa gggagagaat tcgtgttctt gggtctgtcc cgagtgggct
1921 cgcgtgcagc caaacatcag ctctgggtcc aggcgtggcc tcagctggga gcctgtgtcc
1981 tgagcccccg gagcgaaggg gtgcctgggg catcttggcc ctctctgggc agacaatgtg
2041 tgcacctatg tggaaggcca aggacatggg ctgtggccag gcctgtcccg ctcaggcccc
2101 ctgcccggcg gccgtctgtg tgcggggcct ccctcctggc tgtccaggac acagcccgtg
2161 cagccccagc ctggacccag gccatctctg gttgtgtctg tgccgactcg gtgttgaatc
2221 aaatcaggtg tgcgtcagga gccggctgtg tccttcctgc cacactcggg gattcattcc
2281 ttagaaactg aaataaattc taattttgga aactc
//