LOCUS AL365515 3915 bp mRNA linear HUM 14-NOV-2006
DEFINITION Novel human gene mapping to chomosome 22.
ACCESSION AL365515
VERSION AL365515.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3915)
AUTHORS Collins J.E., Huckle E.J.
JOURNAL Submitted (11-JUL-2000) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the bacterial clone 1104E15 (AL022312).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Extends cDNA AK000239.
FEATURES Location/Qualifiers
source 1..3915
/db_xref="H-InvDB:HIT000250554"
/organism="Homo sapiens"
/chromosome="22"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..85
/number=1
misc_feature 1..458
/note="matches EST AW503297 from clone IMAGE:3078442"
misc_feature 22..445
/note="matches EST AW503656 from clone IMAGE:3079476"
exon 86..417
/number=2
misc_feature 258..640
/note="matches EST AW503869 from clone IMAGE:3079076"
exon 418..568
/number=3
misc_feature 423..1047
/note="matches EST AW608306"
CDS 425..1816
/product="hypothetical protein"
/db_xref="GOA:Q9NQG6"
/db_xref="H-InvDB:HIT000250554.15"
/db_xref="HGNC:HGNC:25979"
/db_xref="InterPro:IPR024810"
/db_xref="PDB:4NXT"
/db_xref="PDB:4NXU"
/db_xref="PDB:4NXV"
/db_xref="PDB:4NXW"
/db_xref="PDB:4NXX"
/db_xref="PDB:5X9B"
/db_xref="PDB:5X9C"
/db_xref="UniProtKB/Swiss-Prot:Q9NQG6"
/protein_id="CAB97211.1"
/translation="MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATL
AVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDS
STFDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQA
AVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCI
PGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINW
PAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYD
NLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHL
AQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTL
YCSLSEPEVLLQT"
misc_feature 477..728
/note="matches EST AA355335"
exon 569..746
/number=4
exon 747..1009
/number=5
misc_feature complement(join(914..1304,1697..1769))
/note="matches EST AW452622 from clone IMAGE:3068606"
misc_feature join(929..991,1044..1138,1205..1224)
/note="matches EST AI906985"
misc_feature complement(join(947..1304,1697..1764))
/note="matches EST AI955058 from clone IMAGE:2475652"
misc_feature join(956..1215,1285..1418)
/note="matches EST AI906978"
exon 1010..3915
/number=6
misc_feature join(1069..1092,1106..1351,1352..1385)
/note="matches EST AA446166 from clone IMAGE:780978"
misc_feature join(1367..1444,1445..1689)
/note="matches EST H08262 from clone IMAGE:45260"
misc_feature complement(1373..1768)
/note="matches EST AA429858 from clone IMAGE:780978"
misc_feature join(1561..1712,1709..1744,1759..1800)
/note="matches EST AA093014"
misc_feature join(1611..1918,1917..2017)
/note="matches EST H17738 from clone IMAGE:50693"
misc_feature 1629..1938
/note="matches EST AA306235"
misc_feature complement(join(1660..1676,1684..1767))
/note="matches EST AI055801 from clone IMAGE:1750187"
misc_feature 1794..2087
/note="matches EST AA853018 from clone NHTBCae02c04"
misc_feature join(1832..1879,1878..1988)
/note="matches EST AW601997"
misc_feature 2119..2399
/note="matches EST AA338258"
misc_feature 2273..2550
/note="matches EST AA353768"
misc_feature join(2307..2565,2559..2610,2624..2654)
/note="matches EST R34391 from clone IMAGE:36778"
misc_feature join(2307..2672,2671..2713)
/note="matches EST R59036 from clone IMAGE:41241"
misc_feature join(2311..2564,2560..2720)
/note="matches EST AA251449 from clone IMAGE:684617"
misc_feature 2367..2827
/note="matches EST N27479 from clone IMAGE:264354"
misc_feature join(2369..2710,2680..2713)
/note="matches EST N99653 from clone IMAGE:290621"
misc_feature complement(join(2443..2479,2476..2600))
/note="matches EST AW382918"
misc_feature 2452..2657
/note="matches EST AA340952"
misc_feature join(2477..2825,2819..2845)
/note="matches EST R72316 from clone IMAGE:155888"
misc_feature 2638..2825
/note="matches EST H49886 from clone IMAGE:274195"
misc_feature join(2666..2786,2787..2827,2817..2877)
/note="matches EST AA004963 from clone IMAGE:429147"
misc_feature 2678..2923
/note="matches EST T86041 from clone IMAGE:112827"
misc_feature complement(join(2760..2779,2795..2949,2961..3263))
/note="matches EST N21206 from clone IMAGE:264354"
misc_feature join(2787..2977,2975..3218)
/note="matches EST AA401155 from clone IMAGE:741518"
misc_feature join(2794..3034,3027..3052)
/note="matches EST AA373441"
misc_feature complement(2815..3250)
/note="matches EST AI752279 from clone NHTBC_cn14g01"
misc_feature complement(2821..3263)
/note="matches EST AA827532 from clone IMAGE:1420128"
misc_feature join(2827..2970,2969..3169,3204..3229,3271..3294)
/note="matches EST AA043037 from clone IMAGE:486514"
misc_feature complement(2832..3252)
/note="matches EST AI124836 from clone IMAGE:1539615"
misc_feature join(2888..2970,2969..3271)
/note="matches EST AA081310 from clone IMAGE:549210"
misc_feature complement(join(2906..2949,2961..3271))
/note="matches EST AA081311 from clone IMAGE:549210"
misc_feature complement(2959..3263)
/note="matches EST N71703 from clone IMAGE:290621"
misc_feature complement(3047..3267)
/note="matches EST H17627 from clone IMAGE:50693"
misc_feature complement(join(3110..3405,3422..3646))
/note="matches EST AI885199 from clone IMAGE:2432223"
misc_feature complement(3117..3653)
/note="matches EST AW058655 from clone IMAGE:2552873"
misc_feature join(3117..3452,3442..3538)
/note="matches EST AA456889 from clone IMAGE:815525"
misc_feature complement(join(3130..3168,3167..3478))
/note="matches EST AA679413 from clone IMAGE:432192"
misc_feature complement(3169..3663)
/note="matches EST AI696938 from clone IMAGE:2324526"
misc_feature complement(3182..3654)
/note="matches EST AA457045 from clone IMAGE:815525"
misc_feature complement(3186..3671)
/note="matches EST AW576420 from clone IMAGE:3079076"
misc_feature complement(3191..3660)
/note="matches EST AI371842 from clone IMAGE:2045992"
misc_feature complement(3193..3657)
/note="matches EST AI243820 from clone IMAGE:1853664"
misc_feature complement(join(3205..3312,3324..3654))
/note="matches EST AA004840 from clone IMAGE:429147"
misc_feature complement(3208..3655)
/note="matches EST AI075795 from clone IMAGE:1674738"
misc_feature complement(3212..3671)
/note="matches EST AI753132 from clone HBMSC_cr05f10"
misc_feature complement(3214..3655)
/note="matches EST AA042937 from clone IMAGE:486514"
misc_feature 3219..3621
/note="matches EST AI038154 from clone IMAGE:1647799"
misc_feature complement(join(3230..3665,3661..3793))
/note="matches EST AW387777"
misc_feature join(3233..3402,3398..3664)
/note="matches EST AW387875"
misc_feature complement(join(3233..3665,3661..3787))
/note="matches EST AW387756"
misc_feature complement(join(3239..3665,3661..3744,3764..3793))
/note="matches EST AW387823"
misc_feature complement(3239..3662)
/note="matches EST AW387818"
misc_feature join(3247..3268,3276..3665,3661..3790)
/note="matches EST AW387790"
misc_feature join(3254..3665,3660..3719)
/note="matches EST AW387863"
misc_feature complement(join(3271..3665,3661..3787))
/note="matches EST AW387759"
misc_feature join(3275..3663,3662..3796)
/note="matches EST AW387881"
misc_feature join(3276..3664,3662..3775)
/note="matches EST AW387879"
misc_feature join(3276..3664,3662..3787)
/note="matches EST AW387885"
misc_feature join(3304..3665,3661..3787)
/note="matches EST AW387882"
misc_feature 3343..3671
/note="matches EST AA687186 from clone IMAGE:1211821"
misc_feature 3406..3593
/note="matches EST AA026457 from clone IMAGE:366462"
misc_feature complement(join(3411..3671,3653..3868))
/note="matches EST AI401039 from clone IMAGE:2119482"
misc_feature complement(join(3417..3671,3653..3868))
/note="matches EST AI620938 from clone IMAGE:2250195"
misc_feature complement(3653..3871)
/note="matches EST AA026365 from clone IMAGE:366462"
misc_feature 3661..3787
/note="matches EST AW387835"
misc_feature complement(3696..3867)
/note="matches EST AA613298 from clone IMAGE:1145414"
misc_feature complement(3753..3915)
/note="matches EST AW502829 from clone IMAGE:3077721"
misc_feature 3778..3915
/note="matches EST AA297244"
misc_feature 3817..3914
/note="matches EST AA298573"
BASE COUNT 876 a 994 c 1043 g 1002 t
ORIGIN
1 gaaggggcca tgttgatggg tgacccgggg agaggtaccc ggccagaggc gagtcctgcg
61 gagtggtagc gcgcacggcc tgcggtgtga cacccagccc ctgccagtcc cccatggccc
121 cgtggagccg agaggcggtg ctgagtctct atcgggctct gttgcgccag ggccgacagc
181 ttcgctacac tgatcgagac ttctactttg cctccatccg ccgtgaattc cgaaaaaatc
241 agaagctaga ggacgctgag gcccgggaga ggcagctgga gaagggcctg gtctttctca
301 acggcaaatt ggggaggatc atttaggatc ctccaaggga aagaggacaa aggtgccttc
361 tgtagacact cctgctctct tccatcccca tcttacagat gtattaagaa gcctcagatg
421 agcaatggca ggcgctggtg agcgcaaagg caagaaggat gacaatggca ttggcacggc
481 cattgacttt gtgctctcca atgcccggct ggtgctgggg gtgggtggag cggccatgct
541 gggcatcgcc acgctggcag ttaagcggat gtacgatcgg gcgatcagtg cccctaccag
601 ccccacccgc ctgagccatt cggggaaaag gagctgggaa gaacccaact ggatgggctc
661 cccacgactg ctgaacaggg acatgaagac gggcctgagc cggtccttgc agacccttcc
721 cacagactcc tccaccttcg acacagatac attctgcccg ccccggccca agccagtggc
781 caggaagggc caggtagact tgaagaagtc acgactccgc atgtccctgc aggagaaact
841 tcttacttac taccggaacc gggcagccat ccctgctgga gagcaggctc gggccaagca
901 agctgctgtg gacatatgtg ccgagctccg gagcttcctg cgggccaagt tgcctgacat
961 gccgcttcgg gacatgtact tgagtggcag cctctacgat gacctgcagg tggtgacagc
1021 tgaccacatc caactcattg tgccccttgt gctggagcag aacctgtggt catgtattcc
1081 tggtgaagac accatcatga atgtccctgg cttcttcctg gtgcgtcgtg agaatccaga
1141 gtactttcct cgtgggagca gttactggga ccgctgtgta gtagggggct acctctctcc
1201 aaagacagtc gcagatacat ttgagaaggt agtggctggc tccatcaatt ggccagccat
1261 agggtccctc ttggactatg tgatccgccc ggccccaccc ccagaagccc tcacactgga
1321 ggtgcagtat gagcgtgaca aacatctctt cattgacttc ctgccatcag tgaccctcgg
1381 tgacacagtc ttggtggcca aaccacaccg gctagcccag tatgacaacc tgtggcggct
1441 gagcctgcgt cccgcggaga cggcacgcct gcgggctctg gaccaggctg actcgggctg
1501 ccgatctctg tgcctcaaga tcctcaaggc catatgcaag tccaccccgg ctctgggcca
1561 cctcactgcc agccagctaa ccaatgtcat cctccacttg gcccaggagg aggctgactg
1621 gtctccggat atgctggccg accgtttcct gcaggccttg aggggactta tcagctactt
1681 agaggctgga gtcctgccca gtgccctaaa ccccaaggtg aacttatttg cagagctcac
1741 ccctgaagaa atagacgaat taggatacac tctgtattgc tcattgtctg agccagaggt
1801 gctgctgcag acgtagggca ggtgaaggcc aaagcgggtg ttggtggtca ggccctggat
1861 tctccgttag atacacttgg ctacctagtt ggtgcctcac agggttcctg ctgcctggtg
1921 tcttgctgat catcaccctg gtcacttcat gctgattaga atgacatctc tttcgtctcc
1981 tattttgtta cccaactctt cctatttttg ttaccaatca ctgtgctctc tgccgccccc
2041 tggctccagg ctaatttttc tggaatgaat tgagaaggtg gcgtgctggc ctgagctgat
2101 ggaccacttg gtgttttgcg ttttggccca tgtttgctgc ctctatctgg tctgccttgc
2161 ccgtttgcct gttcctattc agtgtctttt ctattttttc ctctctcgtt catgccttct
2221 gttttgctct tgtccctgga gcatatctgc ctaattaaga tgttgccttt tagttgaatg
2281 ccactgaaga gctgtgatag catgtttcaa agctgaactc tacagagcga gtgctgagac
2341 agtatttagg gtttctggga gtgaggctgg tagaagagtt ggcctttgac cacggttcct
2401 ggagtagaag tccatcctcc ccccaacctc ctgacccatt cataaatgct gagaatgtct
2461 ctcatgggaa cactgttaat gacccacaca ggataagctg aatgcaaagt tatttgcagg
2521 ttgaatttct tggtggctat tagcagaagt gcagagtagg gaaccagagc tggttaaggg
2581 cctagtgaag ggtttgtgtg cccagtgtct gctcgtcatc tgtggctgca ggggtcagac
2641 agacaaggat ggggactgcc agggcaccac ttcatcatga atgctggttt tcacaccttt
2701 tccttatttt attgccaatc aggacaaggc cttgaaggaa cgcagcctta gacatcaggt
2761 gaggatgatg gaggtagaca gtcgactgaa tgtcagctgg aaaatccagt cactagttgg
2821 ggtttggtgg ccatgttttc tacccagaca ggccctgctt ttctaggatg tggccttaga
2881 gcaagaacag acccaacagc cagcccttca tcctccagcg tctgccatag gaatgtgaga
2941 ggggtgtttg ctgagcgctc cgggcacggc cagagggcaa gtgagcatgc acggacctct
3001 tccccctgtc ctgtttctca cccagcacct ggggagatcg gtgctaccaa ggaagagagc
3061 acacagataa gacagagggg aggaggtggg catttcctac attcctcctt gtttgccgct
3121 gctgagattg cagtatttat tgcaatgtaa atgtatcctg aaggtgggga ggaatgttta
3181 atctaccatg tccgtgtgtc atcttggttt gtgtttttcc ctgtttgtag caagactctg
3241 atgataattc tgtttctcat ctgcccattc agtattttgt tttccttccg tcaagttgtc
3301 ttattttttc aatgactacc tctccatcat tgaggttctg gtgaagctct ctgcagctgt
3361 ctcattcctt cccaacgata gtaacaggaa atgactcttt agcatcgata cctcaacatc
3421 aatttagggt agagattcct gcccctcttt tgtcacagat taggaaattg agaactaggg
3481 ttaaccttga ctatatttag aggtcttttt gcctcttttc cccttaacaa ggatttctta
3541 tggtggtttc agtttcattt gcataaaggt attgagaggg aacaaaaaac ataaagctga
3601 gaatcttgag agagctcatc taccctgtct gttggtcaga ctcaaatgag agttaaaaaa
3661 aaaaaaaaaa atctgtatgc ctgagtacca tcctggatga atctagaagg tatggggtag
3721 agcttgacag ggttcctgtg tacccactgg gtatccgtta gaggtaaggg agaggagagg
3781 attgatagag tgttgcaaaa gtatagatta ttcattgaga taaaggattt ggtttccctg
3841 ccatgagtat taaaaaaatt taagttttcc caagcttgca tctctgacca aatttcacat
3901 aaaacattgg aagga
//