LOCUS AL359401 1352 bp mRNA linear HUM 15-OCT-2008 DEFINITION Isoform 1 of a novel human mRNA from chromosome 22. ACCESSION AL359401 VERSION AL359401.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1352) AUTHORS Goward M.E., Huckle E.J. JOURNAL Submitted (15-JUN-2000) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 1191B2 (AL022237). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr22/ Sanger Centre name : bK1191B2.C22.3 FEATURES Location/Qualifiers source 1..1352 /db_xref="H-InvDB:HIT000250444" /organism="Homo sapiens" /chromosome="22" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..439 /number=1 misc_feature join(1..66,105..126) /note="matches EST AA158002 from clone IMAGE:590997" misc_feature join(8..78,105..125,311..344,350..396) /note="matches EST AA252882 from clone IMAGE:669436" CDS 17..1189 /product="hypothetical protein" /db_xref="GOA:Q8IVS2" /db_xref="H-InvDB:HIT000250444.15" /db_xref="HGNC:HGNC:29622" /db_xref="InterPro:IPR001227" /db_xref="InterPro:IPR014043" /db_xref="InterPro:IPR016035" /db_xref="InterPro:IPR016036" /db_xref="InterPro:IPR020801" /db_xref="PDB:2C2N" /db_xref="UniProtKB/Swiss-Prot:Q8IVS2" /protein_id="CAB94789.1" /translation="MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATG AEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDL LELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAAL VFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSL GIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEP AVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIY ERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR" misc_feature join(67..125,350..379) /note="matches EST AA424613 from clone IMAGE:767135" misc_feature join(278..312,310..349,350..530,744..799,795..875, 868..939) /note="matches EST W00496 from clone IMAGE:291272" misc_feature complement(380..725) /note="matches EST R89590 from clone IMAGE:195392" misc_feature join(427..493,493..531,743..1035) /note="matches EST AA453116 from clone IMAGE:788760" misc_feature join(439..530,744..1044) /note="matches EST AA402283 from clone IMAGE:741008" exon 440..527 /number=2 misc_feature 440..654 /note="matches EST H55092 from clone C22_44" exon 528..745 /number=3 misc_feature join(677..857,850..925) /note="matches EST T83116 from clone IMAGE:111020" misc_feature complement(744..1349) /note="matches EST AW071945 from clone IMAGE:2501246" exon 746..1352 /number=4 misc_feature complement(749..830) /note="matches EST AA883936 from clone IMAGE:1390199" misc_feature complement(749..1350) /note="matches EST AI871497 from clone IMAGE:2430010" misc_feature complement(749..1352) /note="matches EST AW071710 from clone IMAGE:2501031" misc_feature complement(749..1084) /note="matches EST AI833136 from clone IMAGE:2377847" misc_feature complement(749..1349) /note="matches EST AI309632 from clone IMAGE:1914588" misc_feature complement(join(788..1052,1021..1349)) /note="matches EST AA779466 from clone IMAGE:1032422" misc_feature join(799..1052,1126..1160,1158..1184,1192..1232) /note="matches EST AA022847 from clone IMAGE:364666" misc_feature complement(804..1349) /note="matches EST AI826142 from clone IMAGE:2418134" misc_feature complement(806..1348) /note="matches EST AI221145 from clone IMAGE:1842533" misc_feature join(808..847,864..1283) /note="matches EST AW373043" misc_feature complement(829..1347) /note="matches EST AA983711 from clone IMAGE:1557618" misc_feature complement(860..915) /note="matches EST AA158003 from clone IMAGE:590997" misc_feature complement(join(869..1052,1021..1348)) /note="matches EST AA527485 from clone IMAGE:937031" misc_feature complement(869..1349) /note="matches EST AI740646 from clone IMAGE:2365977" misc_feature complement(898..1349) /note="matches EST AI095109 from clone IMAGE:1687176" misc_feature complement(901..1349) /note="matches EST AI291372 from clone IMAGE:1894916" misc_feature 910..1348 /note="matches EST F33788 from clone s3000039B05" misc_feature complement(952..1349) /note="matches EST AI914402 from clone IMAGE:2331388" misc_feature 1021..1352 /note="matches EST F25799 from clone s4000044B04" misc_feature complement(1037..1352) /note="matches EST AA974945 from clone IMAGE:1555476" misc_feature 1084..1352 /note="matches EST F35728 from clone sH5-000009-0/F01" misc_feature complement(1126..1352) /note="matches EST T03864 from clone Cot250Ft" misc_feature complement(1144..1352) /note="matches EST AW238348 from clone IMAGE:2740997" misc_feature complement(1234..1352) /note="matches EST AI379511 from clone IMAGE:2069373" BASE COUNT 268 a 398 c 420 g 266 t ORIGIN 1 gggcaggtgt ccgaccatga gcgtccgggt cgcacgggta gcgtgggtca ggggcttggg 61 cgccagctac cgccgcggcg cctcgagctt cccggtgcct ccgccgggcg cccagggtgt 121 agcggagctg ctgcgagatg cgaccggggc ggaggaggag gcgccctggg cggcgacgga 181 gcggcgaatg ccgggccagt gctccgtgct gctcttcccg ggccagggca gccaggtggt 241 gggcatgggc cgcggtctgc tcaactaccc gcgcgtccgc gaactctacg ccgccgcccg 301 ccgcgtgctg ggctacgacc tgctggaact gagcctgcac gggccgcagg agaccctgga 361 ccgcaccgtg cactgtcagc ccgcgatctt cgtggcatcg ctggccgctg tcgagaaact 421 acatcacctg cagccctcgg tgattgagaa ctgtgttgct gctgctggat tcagtgtggg 481 agagtttgca gccctagtgt ttgccggagc catggaattt gctgaaggtt tgtatgcagt 541 gaaaatccga gctgaggcca tgcaggaagc ttcagaagct gtccccagtg ggatgctgtc 601 tgtcctcggc cagcctcagt ccaagttcaa cttcgcctgt ttggaagccc gggaacactg 661 caagtcttta ggcatagaga accccgtatg tgaagtgtcc aactacctct ttccagattg 721 cagggtgatt tcaggacacc aagaggctct acggtttctc cagaagaatt cctctaagtt 781 tcatttcaga cgcaccagga tgttgccggt tagtggcgca ttccacaccc gcctcatgga 841 gccagccgtg gagcccctga cgcaagcttt aaaggcagtc gacattaaga agcctctggt 901 ttctgtctac tccaacgtcc acgcgcatag atacaggcat cccgggcaca tccacaagct 961 gctggcccag cagctggtct ccccagtgaa gtgggagcag acgatgcatg ccatatacga 1021 aaggaaaaag ggcagggggt tcccccaaac tttcgaagta ggccctggca ggcagctggg 1081 agccatcctg aagagctgta acatgcaggc ctggaagtcc tacagcgccg tggatgtgct 1141 gcagaccctc gaacatgtgg acctggaccc tcaggagccc ccgagatgac tgcagggggc 1201 tcaaatgcga tgaccccctc tgtcctcctg aggagaggct gtaggctgtg cctgtcgccc 1261 cctaccttcc taatggctcc tcctctgagg agtgaaaggg atttgtttgc aacgtgcttt 1321 gaaggccaca taaaaagccc taaaaatgag ta //