LOCUS       AL359401                1352 bp    mRNA    linear   HUM 15-OCT-2008
DEFINITION  Isoform 1 of a novel human mRNA from chromosome 22.
ACCESSION   AL359401
VERSION     AL359401.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1352)
  AUTHORS   Goward M.E., Huckle E.J.
  JOURNAL   Submitted (15-JUN-2000) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 1191B2 (AL022237).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr22/
            Sanger Centre name : bK1191B2.C22.3
FEATURES             Location/Qualifiers
     source          1..1352
                     /db_xref="H-InvDB:HIT000250444"
                     /organism="Homo sapiens"
                     /chromosome="22"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..439
                     /number=1
     misc_feature    join(1..66,105..126)
                     /note="matches EST AA158002 from clone IMAGE:590997"
     misc_feature    join(8..78,105..125,311..344,350..396)
                     /note="matches EST AA252882 from clone IMAGE:669436"
     CDS             17..1189
                     /product="hypothetical protein"
                     /db_xref="GOA:Q8IVS2"
                     /db_xref="H-InvDB:HIT000250444.15"
                     /db_xref="HGNC:HGNC:29622"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016036"
                     /db_xref="InterPro:IPR020801"
                     /db_xref="PDB:2C2N"
                     /db_xref="UniProtKB/Swiss-Prot:Q8IVS2"
                     /protein_id="CAB94789.1"
                     /translation="MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATG
                     AEEEAPWAATERRMPGQCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDL
                     LELSLHGPQETLDRTVHCQPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAAL
                     VFAGAMEFAEGLYAVKIRAEAMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSL
                     GIENPVCEVSNYLFPDCRVISGHQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEP
                     AVEPLTQALKAVDIKKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIY
                     ERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR"
     misc_feature    join(67..125,350..379)
                     /note="matches EST AA424613 from clone IMAGE:767135"
     misc_feature    join(278..312,310..349,350..530,744..799,795..875,
                     868..939)
                     /note="matches EST W00496 from clone IMAGE:291272"
     misc_feature    complement(380..725)
                     /note="matches EST R89590 from clone IMAGE:195392"
     misc_feature    join(427..493,493..531,743..1035)
                     /note="matches EST AA453116 from clone IMAGE:788760"
     misc_feature    join(439..530,744..1044)
                     /note="matches EST AA402283 from clone IMAGE:741008"
     exon            440..527
                     /number=2
     misc_feature    440..654
                     /note="matches EST H55092 from clone C22_44"
     exon            528..745
                     /number=3
     misc_feature    join(677..857,850..925)
                     /note="matches EST T83116 from clone IMAGE:111020"
     misc_feature    complement(744..1349)
                     /note="matches EST AW071945 from clone IMAGE:2501246"
     exon            746..1352
                     /number=4
     misc_feature    complement(749..830)
                     /note="matches EST AA883936 from clone IMAGE:1390199"
     misc_feature    complement(749..1350)
                     /note="matches EST AI871497 from clone IMAGE:2430010"
     misc_feature    complement(749..1352)
                     /note="matches EST AW071710 from clone IMAGE:2501031"
     misc_feature    complement(749..1084)
                     /note="matches EST AI833136 from clone IMAGE:2377847"
     misc_feature    complement(749..1349)
                     /note="matches EST AI309632 from clone IMAGE:1914588"
     misc_feature    complement(join(788..1052,1021..1349))
                     /note="matches EST AA779466 from clone IMAGE:1032422"
     misc_feature    join(799..1052,1126..1160,1158..1184,1192..1232)
                     /note="matches EST AA022847 from clone IMAGE:364666"
     misc_feature    complement(804..1349)
                     /note="matches EST AI826142 from clone IMAGE:2418134"
     misc_feature    complement(806..1348)
                     /note="matches EST AI221145 from clone IMAGE:1842533"
     misc_feature    join(808..847,864..1283)
                     /note="matches EST AW373043"
     misc_feature    complement(829..1347)
                     /note="matches EST AA983711 from clone IMAGE:1557618"
     misc_feature    complement(860..915)
                     /note="matches EST AA158003 from clone IMAGE:590997"
     misc_feature    complement(join(869..1052,1021..1348))
                     /note="matches EST AA527485 from clone IMAGE:937031"
     misc_feature    complement(869..1349)
                     /note="matches EST AI740646 from clone IMAGE:2365977"
     misc_feature    complement(898..1349)
                     /note="matches EST AI095109 from clone IMAGE:1687176"
     misc_feature    complement(901..1349)
                     /note="matches EST AI291372 from clone IMAGE:1894916"
     misc_feature    910..1348
                     /note="matches EST F33788 from clone s3000039B05"
     misc_feature    complement(952..1349)
                     /note="matches EST AI914402 from clone IMAGE:2331388"
     misc_feature    1021..1352
                     /note="matches EST F25799 from clone s4000044B04"
     misc_feature    complement(1037..1352)
                     /note="matches EST AA974945 from clone IMAGE:1555476"
     misc_feature    1084..1352
                     /note="matches EST F35728 from clone sH5-000009-0/F01"
     misc_feature    complement(1126..1352)
                     /note="matches EST T03864 from clone Cot250Ft"
     misc_feature    complement(1144..1352)
                     /note="matches EST AW238348 from clone IMAGE:2740997"
     misc_feature    complement(1234..1352)
                     /note="matches EST AI379511 from clone IMAGE:2069373"
BASE COUNT          268 a          398 c          420 g          266 t
ORIGIN      
        1 gggcaggtgt ccgaccatga gcgtccgggt cgcacgggta gcgtgggtca ggggcttggg
       61 cgccagctac cgccgcggcg cctcgagctt cccggtgcct ccgccgggcg cccagggtgt
      121 agcggagctg ctgcgagatg cgaccggggc ggaggaggag gcgccctggg cggcgacgga
      181 gcggcgaatg ccgggccagt gctccgtgct gctcttcccg ggccagggca gccaggtggt
      241 gggcatgggc cgcggtctgc tcaactaccc gcgcgtccgc gaactctacg ccgccgcccg
      301 ccgcgtgctg ggctacgacc tgctggaact gagcctgcac gggccgcagg agaccctgga
      361 ccgcaccgtg cactgtcagc ccgcgatctt cgtggcatcg ctggccgctg tcgagaaact
      421 acatcacctg cagccctcgg tgattgagaa ctgtgttgct gctgctggat tcagtgtggg
      481 agagtttgca gccctagtgt ttgccggagc catggaattt gctgaaggtt tgtatgcagt
      541 gaaaatccga gctgaggcca tgcaggaagc ttcagaagct gtccccagtg ggatgctgtc
      601 tgtcctcggc cagcctcagt ccaagttcaa cttcgcctgt ttggaagccc gggaacactg
      661 caagtcttta ggcatagaga accccgtatg tgaagtgtcc aactacctct ttccagattg
      721 cagggtgatt tcaggacacc aagaggctct acggtttctc cagaagaatt cctctaagtt
      781 tcatttcaga cgcaccagga tgttgccggt tagtggcgca ttccacaccc gcctcatgga
      841 gccagccgtg gagcccctga cgcaagcttt aaaggcagtc gacattaaga agcctctggt
      901 ttctgtctac tccaacgtcc acgcgcatag atacaggcat cccgggcaca tccacaagct
      961 gctggcccag cagctggtct ccccagtgaa gtgggagcag acgatgcatg ccatatacga
     1021 aaggaaaaag ggcagggggt tcccccaaac tttcgaagta ggccctggca ggcagctggg
     1081 agccatcctg aagagctgta acatgcaggc ctggaagtcc tacagcgccg tggatgtgct
     1141 gcagaccctc gaacatgtgg acctggaccc tcaggagccc ccgagatgac tgcagggggc
     1201 tcaaatgcga tgaccccctc tgtcctcctg aggagaggct gtaggctgtg cctgtcgccc
     1261 cctaccttcc taatggctcc tcctctgagg agtgaaaggg atttgtttgc aacgtgcttt
     1321 gaaggccaca taaaaagccc taaaaatgag ta
//