LOCUS AL355841 1252 bp mRNA linear HUM 14-NOV-2006
DEFINITION Novel human gene mapping to chomosome 22.
ACCESSION AL355841
VERSION AL355841.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1252)
AUTHORS Goward M.E., Huckle E.J.
JOURNAL Submitted (10-MAY-2000) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the bacterial clones 185D5 (AL118498) and
246D7 (AL031843).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
Sanger Centre name : dJ185D5.C22.1
FEATURES Location/Qualifiers
source 1..1252
/db_xref="H-InvDB:HIT000250388"
/organism="Homo sapiens"
/chromosome="22"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..57
/number=1
CDS 55..1143
/product="hypothetical protein"
/db_xref="GOA:Q5THR3"
/db_xref="H-InvDB:HIT000250388.14"
/db_xref="HGNC:HGNC:24204"
/db_xref="InterPro:IPR002048"
/db_xref="InterPro:IPR011992"
/db_xref="InterPro:IPR015070"
/db_xref="InterPro:IPR018247"
/db_xref="PDB:1WLZ"
/db_xref="PDB:5D67"
/db_xref="UniProtKB/Swiss-Prot:Q5THR3"
/protein_id="CAB91065.1"
/translation="MTADEWAEKMPKGPPPTSPKATADRDILARLHKAVTSHYHAITQ
EFENFDTMKTNTISREEFRAICNRRVQILTDEQFDRLWNEMPVNAKGRLKYPDFLSRF
SSETAATPMATGDSAVAQRGSSVPDVSEGTRSALSLPTQELRPGSKSQSHPCTPASTT
VIPGTPPLQNCDPIESRLRKRIQGCWRQLLKECKEKDVARQGDINASDFLALVEKFNL
DISKEECQQLIIKYDLKSNGKFAYCDFIQSCVLLLKAKESSLMHRMKIQNAHKMKEAG
AETPSFYSALLRIQPKIVHCWRPMRRTFKSYDEAGTGLLSVADFRTVLRQYSINLSEE
EFFHILEYYDKTLSSKISYNDFLRAFLQ"
exon 58..285
/number=2
misc_feature complement(join(151..187,182..270))
/note="matches EST H55431 from clone C22_481"
exon 286..516
/number=3
exon 517..685
/number=4
misc_feature 668..803
/note="matches EST AA453966 from clone IMAGE:795170"
misc_feature complement(671..1218)
/note="matches EST AA725842 from clone 1343823"
exon 686..870
/number=5
misc_feature join(696..746,745..870)
/note="matches EST H55405 from clone C22_443"
misc_feature complement(766..1239)
/note="matches EST AW139921 from clone IMAGE:2719142"
misc_feature complement(799..1222)
/note="matches EST AI651885 from clone IMAGE:2310424"
misc_feature complement(join(799..952,947..1222))
/note="matches EST AI971598 from clone IMAGE:2479065"
misc_feature complement(825..1216)
/note="matches EST AA453466 from clone IMAGE:795170"
misc_feature 870..1247
/note="matches EST AL110422 from clone DKFZp434L1831"
exon 871..1020
/number=6
misc_feature complement(871..1216)
/note="matches EST AI027229 from clone IMAGE:1643919"
misc_feature complement(878..1216)
/note="matches EST AI026797 from clone IMAGE:1645308"
misc_feature complement(882..1252)
/note="matches EST AA778573 from clone 1048920"
misc_feature complement(891..1219)
/note="matches EST AI279962 from clone IMAGE:1854242"
misc_feature complement(join(957..1022,1018..1217))
/note="matches EST AI073425 from clone IMAGE:1640357"
exon 1021..1252
/number=7
BASE COUNT 354 a 333 c 315 g 250 t
ORIGIN
1 aagatgtttt ttgttccaag agagaagtga agaatgtagt tttcaaccaa agggatgaca
61 gctgatgagt gggctgagaa aatgcccaaa ggcccgccgc ctacctctcc caaggccaca
121 gccgacagag acatcctggc tcgcctccac aaagcagtga cttcccatta ccatgccatc
181 acccaggagt ttgagaattt tgacaccatg aaaacgaaca ccatctccag agaggagttt
241 agggccattt gtaatcgccg cgtccaaatc ctgacggacg aacagtttga cagactctgg
301 aacgagatgc cagtcaatgc caaggggagg ctgaaatacc cggacttcct gagcaggttc
361 agttccgaga cagcagccac accaatggcc actggtgact cggccgtggc ccagagaggg
421 agcagtgtcc ctgacgtctc ggaaggcacc agatctgccc tctcattgcc cactcaggag
481 ctgagaccag ggtcaaagtc gcagagccac ccctgtactc cagcgagcac caccgtgatc
541 ccgggcactc cacccttgca gaactgtgat cccatagaga gcaggctccg gaagagaatc
601 cagggctgct ggcgccagct cctgaaagaa tgcaaggaga aggacgtggc cagacagggg
661 gacatcaacg cctccgattt cctggctctt gtggagaaat tcaacctgga cataagcaaa
721 gaggagtgtc agcagctcat tataaaatac gacttaaaga gcaacgggaa atttgcatac
781 tgtgacttca ttcagagctg tgtcctcctg ctaaaagcaa aggaaagctc actgatgcac
841 aggatgaaga tccagaatgc acacaagatg aaagaagccg gcgcggagac gccatctttt
901 tactctgctc tgctgcgtat tcagcccaaa attgtgcact gctggaggcc aatgcggcgc
961 acgttcaaaa gctatgatga ggctggaaca gggctgctaa gcgtcgcaga tttcaggacg
1021 gtcctgagac agtacagcat caacctctct gaggaagagt tcttccatat tctggagtat
1081 tacgataaga cgctgtcttc aaaaatctcc tacaacgact tcctccgggc attcctccag
1141 tagacacccc tgctgtgtgc ccagcgggac gacagccaca gggcctgttt caaggctaat
1201 aaaatcctat aatttggggg tttcatgaat tttcaaaaaa aacaaaactc aa
//