LOCUS       AL355092                 999 bp    mRNA    linear   HUM 15-OCT-2008
DEFINITION  Novel human gene mapping to chomosome 22.
ACCESSION   AL355092
VERSION     AL355092.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 999)
  AUTHORS   Goward M.E., Huckle E.J.
  JOURNAL   Submitted (25-APR-2000) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 671O14 (AL031595).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr22/
            Sanger Centre name : dJ671O14.C22.2
FEATURES             Location/Qualifiers
     source          1..999
                     /db_xref="H-InvDB:HIT000250334"
                     /organism="Homo sapiens"
                     /chromosome="22"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..179
                     /number=1
     misc_feature    74..394
                     /note="matches EST AA309454"
     misc_feature    123..246
                     /note="matches EST AA280188 from clone IMAGE:712107"
     misc_feature    146..270
                     /note="matches EST AA488785 from clone IMAGE:824741"
     exon            180..270
                     /number=2
     CDS             192..755
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9HBI0"
                     /db_xref="H-InvDB:HIT000250334.12"
                     /db_xref="HGNC:HGNC:14654"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR028433"
                     /db_xref="InterPro:IPR036872"
                     /db_xref="UniProtKB/Swiss-Prot:Q9HBI0"
                     /protein_id="CAB90188.1"
                     /translation="MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFE
                     ELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQ
                     KHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNV
                     QVEVITIESTKSGLKSEKLVEQLTEYR"
     misc_feature    join(222..492,491..508,514..536)
                     /note="matches EST AA354389"
     exon            271..335
                     /number=3
     exon            336..438
                     /number=4
     misc_feature    336..441
                     /note="matches EST H55730 from clone C22_930"
     exon            439..579
                     /number=5
     misc_feature    join(561..642,639..997)
                     /note="matches EST AW380333"
     exon            580..695
                     /number=6
     misc_feature    582..751
                     /note="matches EST H55711 from clone C22_898"
     misc_feature    join(582..668,695..751)
                     /note="matches EST H55713 from clone C22_901"
     exon            696..776
                     /number=7
     exon            777..833
                     /number=8
     misc_feature    complement(814..999)
                     /note="matches EST AW378128"
     misc_feature    829..902
                     /note="matches EST H55275 from clone C22_267"
     exon            834..902
                     /number=9
     misc_feature    complement(856..999)
                     /note="matches EST AI540087 from clone IMAGE:2075127"
     exon            903..999
                     /number=10
     misc_feature    903..999
                     /note="matches EST H55366 from clone C22_382"
     misc_feature    944..999
                     /note="matches EST AW385311"
BASE COUNT          235 a          275 c          296 g          193 t
ORIGIN      
        1 cagagaggag gaagctcctg ccggctgagc gggcctggag gaagtgagca gcggggctcc
       61 tgcctcccgg cctggtcccc gaagacccca gaagaacccg gaacttgctt ccattcggaa
      121 tccagggacc accctttgca ctcagtaggc ctttgttttc ctgcgtggaa agcggttggg
      181 cttgggaggc gatggagccg gagttcttgt acgacctgct gcagctcccc aagggggtgg
      241 agcccccagc ggaggaggag ctctcaaaag gaggaaagaa gaaatacctg ccacccactt
      301 cccggaagga ccccaaattt gaagaactgc agaaggtgtt gatggagtgg atcaatgcca
      361 ctcttctccc cgagcacatt gtggtccgca gcctggagga ggacatgttc gacgggctca
      421 tcctacacca cctattccag aggctggcgg cgctcaagct ggaagcagag gacatcgccc
      481 tgacagccac aagccagaag cacaagctca cagtggtgct ggaggccgtg aaccggagtc
      541 tgcagctgga ggagtggcag gccaagtgga gcgtggagag catcttcaac aaggacctgt
      601 tgtctaccct gcacctcctt gtggccctgg ccaagcgctt ccagcccgac ctctccctcc
      661 caaccaacgt ccaggtggag gtcatcacta tcgagagcac caaaagtggt ctgaagtcag
      721 agaagttggt ggaacagctc actgaataca ggtgagggaa ggatgagggc ccatgggacg
      781 tctttgatga attatttaag ctggctccgg agaaagtgaa cgcagtgaaa gaggccatcg
      841 tgaactttgt caaccagaag ctggaccgcc tgggcctgtc tgtgcagaat ctggacaccc
      901 agtttgcaga tggggtcatc ttactcttgc tgattggaca acttgaaggc ttcttcctgc
      961 acttaaagga attctacctc actcccaact ctcctgcag
//