LOCUS AL355092 999 bp mRNA linear HUM 15-OCT-2008 DEFINITION Novel human gene mapping to chomosome 22. ACCESSION AL355092 VERSION AL355092.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 999) AUTHORS Goward M.E., Huckle E.J. JOURNAL Submitted (25-APR-2000) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 671O14 (AL031595). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr22/ Sanger Centre name : dJ671O14.C22.2 FEATURES Location/Qualifiers source 1..999 /db_xref="H-InvDB:HIT000250334" /organism="Homo sapiens" /chromosome="22" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..179 /number=1 misc_feature 74..394 /note="matches EST AA309454" misc_feature 123..246 /note="matches EST AA280188 from clone IMAGE:712107" misc_feature 146..270 /note="matches EST AA488785 from clone IMAGE:824741" exon 180..270 /number=2 CDS 192..755 /product="hypothetical protein" /db_xref="GOA:Q9HBI0" /db_xref="H-InvDB:HIT000250334.12" /db_xref="HGNC:HGNC:14654" /db_xref="InterPro:IPR001715" /db_xref="InterPro:IPR028433" /db_xref="InterPro:IPR036872" /db_xref="UniProtKB/Swiss-Prot:Q9HBI0" /protein_id="CAB90188.1" /translation="MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFE ELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQ KHKLTVVLEAVNRSLQLEEWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNV QVEVITIESTKSGLKSEKLVEQLTEYR" misc_feature join(222..492,491..508,514..536) /note="matches EST AA354389" exon 271..335 /number=3 exon 336..438 /number=4 misc_feature 336..441 /note="matches EST H55730 from clone C22_930" exon 439..579 /number=5 misc_feature join(561..642,639..997) /note="matches EST AW380333" exon 580..695 /number=6 misc_feature 582..751 /note="matches EST H55711 from clone C22_898" misc_feature join(582..668,695..751) /note="matches EST H55713 from clone C22_901" exon 696..776 /number=7 exon 777..833 /number=8 misc_feature complement(814..999) /note="matches EST AW378128" misc_feature 829..902 /note="matches EST H55275 from clone C22_267" exon 834..902 /number=9 misc_feature complement(856..999) /note="matches EST AI540087 from clone IMAGE:2075127" exon 903..999 /number=10 misc_feature 903..999 /note="matches EST H55366 from clone C22_382" misc_feature 944..999 /note="matches EST AW385311" BASE COUNT 235 a 275 c 296 g 193 t ORIGIN 1 cagagaggag gaagctcctg ccggctgagc gggcctggag gaagtgagca gcggggctcc 61 tgcctcccgg cctggtcccc gaagacccca gaagaacccg gaacttgctt ccattcggaa 121 tccagggacc accctttgca ctcagtaggc ctttgttttc ctgcgtggaa agcggttggg 181 cttgggaggc gatggagccg gagttcttgt acgacctgct gcagctcccc aagggggtgg 241 agcccccagc ggaggaggag ctctcaaaag gaggaaagaa gaaatacctg ccacccactt 301 cccggaagga ccccaaattt gaagaactgc agaaggtgtt gatggagtgg atcaatgcca 361 ctcttctccc cgagcacatt gtggtccgca gcctggagga ggacatgttc gacgggctca 421 tcctacacca cctattccag aggctggcgg cgctcaagct ggaagcagag gacatcgccc 481 tgacagccac aagccagaag cacaagctca cagtggtgct ggaggccgtg aaccggagtc 541 tgcagctgga ggagtggcag gccaagtgga gcgtggagag catcttcaac aaggacctgt 601 tgtctaccct gcacctcctt gtggccctgg ccaagcgctt ccagcccgac ctctccctcc 661 caaccaacgt ccaggtggag gtcatcacta tcgagagcac caaaagtggt ctgaagtcag 721 agaagttggt ggaacagctc actgaataca ggtgagggaa ggatgagggc ccatgggacg 781 tctttgatga attatttaag ctggctccgg agaaagtgaa cgcagtgaaa gaggccatcg 841 tgaactttgt caaccagaag ctggaccgcc tgggcctgtc tgtgcagaat ctggacaccc 901 agtttgcaga tggggtcatc ttactcttgc tgattggaca acttgaaggc ttcttcctgc 961 acttaaagga attctacctc actcccaact ctcctgcag //