LOCUS AL159142 1624 bp mRNA linear HUM 15-OCT-2008
DEFINITION Novel human gene mapping to chomosome 22.
ACCESSION AL159142
VERSION AL159142.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1624)
AUTHORS Goward M.E., Huckle E.J.
JOURNAL Submitted (06-MAR-2000) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the cosmids 79B4 (Z82178) and cB20F6
(Z82174),
BAC 414D7 (AL033543) and PAC 671O14 (AL031595).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
Sanger Centre name : cB79B4.C22.2
FEATURES Location/Qualifiers
source 1..1624
/db_xref="H-InvDB:HIT000250319"
/organism="Homo sapiens"
/chromosome="22"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..86
/number=1
CDS 17..1069
/product="hypothetical protein"
/db_xref="GOA:Q9HBI1"
/db_xref="H-InvDB:HIT000250319.15"
/db_xref="HGNC:HGNC:14653"
/db_xref="InterPro:IPR001715"
/db_xref="InterPro:IPR028433"
/db_xref="InterPro:IPR036872"
/db_xref="PDB:4EDL"
/db_xref="PDB:4EDM"
/db_xref="PDB:4EDN"
/db_xref="UniProtKB/Swiss-Prot:Q9HBI1"
/protein_id="CAB76900.1"
/translation="MKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALV
DVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLY
DGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSI
HGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEM
MMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVL
LMGLLEDYFVPLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKS
TLRVLYNLFTKYKNVE"
exon 87..176
/number=2
misc_feature join(118..145,286..303,303..355,372..429)
/note="matches EST W02112 from clone 292016"
exon 177..247
/number=3
misc_feature join(179..305,311..356)
/note="matches EST AA157396 from clone 589514"
misc_feature join(180..436,439..483,487..805)
/note="matches EST AA181053 from clone 625220"
exon 248..350
/number=4
misc_feature 248..350
/note="matches EST H55609 from clone C22_747"
exon 351..491
/number=5
exon 492..607
/number=6
misc_feature complement(join(513..561,556..686))
/note="matches EST N73272 from clone 292016"
misc_feature join(575..751,760..796)
/note="matches EST C18689"
misc_feature join(607..890,890..936)
/note="matches EST R06059 from clone 124951"
exon 608..666
/number=7
misc_feature join(608..712,713..734,734..794)
/note="matches EST AA005309 from clone 428878"
misc_feature join(611..740,739..794,808..828)
/note="matches EST R32918 from clone 135180"
misc_feature 612..670
/note="matches EST H55521 from clone C22_621"
exon 667..686
/number=8
misc_feature 667..817
/note="matches EST H55693 from clone C22_872"
exon 687..748
/number=9
misc_feature join(705..740,738..855,851..956,989..1007)
/note="matches EST R79741 from clone 146399"
misc_feature 731..1018
/note="matches EST T39668 from clone 61011"
exon 749..817
/number=10
misc_feature join(749..956,962..1007,1004..1034)
/note="matches EST R10625 from clone 128442"
misc_feature complement(773..1315)
/note="matches EST AI052260 from clone IMAGE:1675981"
misc_feature join(818..921,816..919)
/note="matches EST H55200 from clone C22_177"
exon 818..919
/number=11
misc_feature complement(824..1312)
/note="matches EST AI095515 from clone IMAGE:1697647"
misc_feature complement(848..1224)
/note="matches EST M85753 from clone HFBCN16,"
misc_feature complement(851..1315)
/note="matches EST AW075607 from clone IMAGE:2577255"
misc_feature complement(join(851..875,870..1017,1018..1310))
/note="matches EST AI014910 from clone IMAGE:1623250"
misc_feature 880..1265
/note="matches EST F37567 from clone sH1-000005-0/F04"
misc_feature complement(893..1317)
/note="matches EST AI078029 from clone IMAGE:1674434"
misc_feature complement(join(908..1022,1013..1315))
/note="matches EST W86572 from clone 416739"
exon 920..992
/number=12
misc_feature 920..992
/note="matches EST H55198 from clone C22_175"
misc_feature 939..1273
/note="matches EST F27948 from clone s4000028E08"
misc_feature complement(940..1315)
/note="matches EST AW014232 from clone IMAGE:2709476"
misc_feature complement(962..1317)
/note="matches EST AI688769 from clone IMAGE:2326042"
misc_feature 963..992
/note="matches EST AA431157 from clone 781682"
misc_feature 963..1131
/note="matches EST N72759 from clone 288982"
misc_feature 986..1188
/note="matches EST T30762"
misc_feature complement(992..1318)
/note="matches EST AA432178 from clone 781682"
exon 993..1624
/number=13
misc_feature join(1011..1204,1195..1279,1279..1315)
/note="matches EST AA082114 from clone 550081"
misc_feature complement(join(1092..1113,1193..1436))
/note="matches EST AA187563 from clone 625220"
misc_feature complement(1126..1624)
/note="matches EST AA541639 from clone IMAGE:984989"
misc_feature complement(join(1171..1264,1270..1618))
/note="matches EST N59812 from clone 288982"
misc_feature complement(1173..1612)
/note="matches EST AI591109 from clone IMAGE:2267043"
misc_feature complement(1189..1617)
/note="matches EST AI934566 from clone IMAGE:2464350"
/note="matches EST AI754438 from clone HBMSC_cr25d01"
misc_feature complement(1190..1613)
/note="matches EST AW043703 from clone IMAGE:2554849"
misc_feature complement(join(1194..1438,1440..1599))
/note="matches EST T48378 from clone 74203"
misc_feature complement(1216..1617)
/note="matches EST AI803436 from clone IMAGE:2067005"
misc_feature complement(1232..1437)
/note="matches EST AA235867 from clone 687770"
misc_feature complement(1266..1612)
/note="matches EST AI202207 from clone IMAGE:1943369"
misc_feature complement(1284..1617)
/note="matches EST AA912921 from clone IMAGE:1525236"
misc_feature 1286..1616
/note="matches EST F25335 from clone s4000036C10,"
misc_feature complement(join(1288..1446,1447..1616))
/note="matches EST AA788580 from clone 1127161"
misc_feature 1322..1600
/note="matches EST F35741 from clone sH5-000009-0/B12"
misc_feature complement(1332..1621)
/note="matches EST AI678124 from clone IMAGE:2316036"
misc_feature complement(1394..1615)
/note="matches EST AI769365 from clone IMAGE:2402686"
misc_feature complement(1550..1617)
/note="matches EST T40719 from clone 61011"
BASE COUNT 368 a 445 c 470 g 341 t
ORIGIN
1 cccgcggccc cgcaggatga agaaggacga gtcgttcctg ggcaagctgg gcggcaccct
61 ggccaggaag cggagggcgc gcgaggtgag tgacctgcag gaagaaggca agaatgccat
121 caactcaccg atgtcccccg ccctggtgga tgttcaccct gaagacaccc agcttgagga
181 gaacgaggag cgcacgatga ttgaccccac ttccaaggaa gaccccaagt tcaaggaact
241 ggtcaaggtc ctcctcgact ggattaatga cgtgctggtg gaggagagga tcattgtgaa
301 gcagctggag gaagacctgt atgacggcca ggtgctgcag aagctcttgg aaaaactggc
361 agggtgcaag ctgaatgtgg ctgaggtgac acagtccgaa atagggcaga aacagaagct
421 gcagacggtg ctggaagcag tacatgacct gctgcggccc cgaggctggg cgctccggtg
481 gagcgtggac tcaattcacg ggaagaacct ggtggccatc ctccacctgc tggtctctct
541 ggccatgcac ttcagggccc ccatccgcct tcctgagcat gtaacggtgc aggtggtggt
601 cgtgcggaaa cgggaaggcc tgctgcattc cagccacatc tcggaggagc tgaccacaac
661 tacagagatg atgatgggcc ggttcgagcg ggatgccttc gacacgctgt tcgaccacgc
721 cccggataag ctcagcgtgg tgaagaagtc tctcatcact tttgtgaaca agcacctgaa
781 caagctgaat ttggaggtga cggaactgga gacccagttt gcagatggcg tgtacctggt
841 tctgctcatg ggccttctgg aagactactt tgttcctctc caccacttct acctgactcc
901 ggaaagcttc gatcagaagg tccacaatgt gtccttcgcc tttgagctga tgctggacgg
961 aggcctcaag aaacccaagg ctcgtcctga agacgtggtt aacttggacc tcaaatccac
1021 cctgagggtt ctttacaacc tgttcaccaa gtacaagaac gtggagtgac gggggagctg
1081 tggatggtgg caggagtgtc ccagcaagaa aggcggcatc cgtctgtgcc ctgtgccttt
1141 ccagggagcc aggcgccatg ggcttctggt ccaagctgtg ttgactgtca tccccacccc
1201 acccctacct cacgcctgcc ccaccccctg cctcttttgg ttgttgttct taatctcctc
1261 tccatgtagt tcccagtggg caagagcctt tgaaaatgca ggattctaaa cactcgtgct
1321 tgcgtttgaa gcctcgcgtc actcagtcgc gtgggatgat gagtccgttg ttgtctgcct
1381 tggccgaaag atgaaaaaaa gcctgaaccc caacccccag ctggttgaga gcaccctgca
1441 ttctgcctca tggtgcagtt agcgatcaca ggccttcaga agtacaacat cagctcagca
1501 ggaacgccgg ctccccgagg acccaggctt gacgattcac cggggatctc ctgggctggg
1561 ctctccttgg aagtgaggcc ttttattaaa aataaaaggg ttttgcagtt tgaaaaactt
1621 taaa
//