LOCUS AL157501 851 bp mRNA linear HUM 15-OCT-2008
DEFINITION Homo sapiens mRNA; cDNA DKFZp434G155 (from clone DKFZp434G155);
partial cds.
ACCESSION AL157501
VERSION AL157501.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 851)
AUTHORS Duesterhoeft A., Lauber J., Mewes H.W., Weil B., Wiemann S.
JOURNAL Submitted (15-FEB-2000) to the INSDC. MIPS, Am Klopferspitz 18a,
D-82152 Martinsried, GERMANY
COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
sequenced by Qiagen (Hilden/Germany) within the cDNA sequencing
consortium of the German Genome Project.
This clone (DKFZp434G155) is available at the RZPD in Berlin.
Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
Further information about the clone and the sequencing project
is available at http://www.mips.biochem.mpg.de/proj/cDNA/
FEATURES Location/Qualifiers
source 1..851
/db_xref="H-InvDB:HIT000026135_04"
/organism="Homo sapiens"
/mol_type="mRNA"
/dev_stage="adult"
/clone_lib="434 (synonym: htes3). Vector pSport1; host
DH10B; sites NotI + SalI"
/clone="DKFZp434G155"
/tissue_type="testis"
/db_xref="taxon:9606"
CDS 173..703
/codon_start=1
/gene="DKFZp434G155"
/product="hypothetical protein"
/note="protein phosphatase 2A 48 kDa regulatory subunit
(Homo sapiens)"
/db_xref="GOA:Q9NSQ1"
/db_xref="H-InvDB:HIT000026135_03.4"
/db_xref="InterPro:IPR002048"
/db_xref="InterPro:IPR011992"
/db_xref="InterPro:IPR018247"
/db_xref="UniProtKB/TrEMBL:Q9NSQ1"
/protein_id="CAB75680.1"
/translation="MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLD
LVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSD
WEKYAAEEYDILVAEETVGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGA
VDLYEYACGDEDLEPL"
polyA_site 829
BASE COUNT 195 a 245 c 260 g 151 t
ORIGIN
1 gttcctgtga agctctccct gacatgcatc ttcgtctctc catcctggct ttggatctag
61 aggcagaaaa gtgcagaagg aagggaagat cagctatgcc gactttgtct ggtttttgat
121 ctctgaggaa gacaaaaaaa caccgaccag catcgagtac tggttccgct gcatggacct
181 ggacggggac ggcgccctgt ccatgttcga gctcgagtac ttctacgagg agcagtgccg
241 aaggctggac agcatggcca tcgaggccct gcccttccag gactgcctct gccagatgct
301 ggacctggtc aagccgagga ctgaagggaa gatcacgctg caggacctga agcgctgcaa
361 gctggccaac gtcttcttcg acaccttctt caacatcgag aagtacctcg accacgagca
421 gaaagagcag atctccctgc tcagggacgg tgacagcggc ggccccgagc tctcggactg
481 ggagaagtac gcggccgagg agtacgacat cctggtggcc gaggagaccg tgggagagcc
541 ctgggaggac gggttcgagg ccgagctcag ccccgtggag cagaagctga gtgcgctgcg
601 ctccccgctg gcccagaggc ccttcttcga ggcgccctca ccgctgggcg ccgtggacct
661 gtacgagtac gcgtgcgggg acgaggacct ggagccgctg tgacgccacc cgcgagaacg
721 ccgccgcggg gccgcccccc acgtgccacc accgggccac cgcggctcgt gtaaaaactg
781 ttgtggaaaa tgagtgcgtt tgtacggaat gataaacttt tatttattca caaaaaaaaa
841 aaaaaaaaaa a
//