LOCUS AL137188 4126 bp mRNA linear HUM 15-OCT-2008 DEFINITION Novel human gene mapping to chromosome 20, similar to membrane transporters. ACCESSION AL137188 VERSION AL137188.3 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 4126) AUTHORS Stavrides G.S., Hashim Y., Huckle E.J., Deloukas P. JOURNAL Submitted (24-JAN-2000) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 28H20 (AL031055). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr20/ Sanger Centre name : dJ28H20.C20.1 FEATURES Location/Qualifiers source 1..4126 /db_xref="H-InvDB:HIT000250306" /organism="Homo sapiens" /chromosome="20" /map="20q" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..12 /number=1 CDS 9..1634 /product="hypothetical protein" /db_xref="GOA:O95528" /db_xref="H-InvDB:HIT000250306.14" /db_xref="HGNC:HGNC:13444" /db_xref="InterPro:IPR003663" /db_xref="InterPro:IPR005828" /db_xref="InterPro:IPR005829" /db_xref="InterPro:IPR020846" /db_xref="InterPro:IPR036259" /db_xref="UniProtKB/Swiss-Prot:O95528" /protein_id="CAB69822.2" /translation="MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSC LEQEFLVGSLLLGALLASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLV LGRAVVGFAISLSSMACCIYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGT PWGWRHMFGWATAPAVLQSLSLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSF LDLFRARDNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGL GAVKVAATLTAMGLVDRAGRRALLLAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPN ATGQTGLPGDSGLLQDSSLPPIPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALS SALPGPPLPARGHALLRWTALLCLMVFVSAFSFGFGPVTWLVLSEIYPVEIRGRAFAF CNSFNWAANLFISLSFLDLIGTIGLSWTFLLYGLTAVLGLGFIYLFVPETKGQSLAEI DQQFQKRRFTLSFGHRQNSTGIPYSRIEISAAS" exon 13..1296 /number=2 exon 1297..1419 /number=3 misc_feature 1338..1643 /note="matches EST AA313045" exon 1420..1555 /number=4 exon 1556..4126 /number=5 misc_feature 2095..2137 /note="matches EST AA714011 from clone IMAGE:1240821" misc_feature complement(2142..2172) /note="matches EST BE747194 from clone IMAGE:3929520" misc_feature join(2274..2544,2548..2589,2646..2763) /note="matches EST AA007343 from clone IMAGE:429263" misc_feature complement(2311..2352) /note="matches EST AV650272 from clone GLCCDA12" /note="matches EST AV650673 from clone GLCCHC08" /note="matches EST AV650603 from clone GLCCGE10" /note="matches EST AV650406 from clone GLCCEE02" /note="matches EST AV650686 from clone GLCCHD09" misc_feature join(2417..2711,2711..2814,3001..3029) /note="matches EST W02942 from clone IMAGE:291802" misc_feature 2475..2804 /note="matches EST W31922 from clone IMAGE:320524" misc_feature join(2476..2695,2693..2817) /note="matches EST AA489718 from clone IMAGE:823660" misc_feature join(2647..2694,2693..3059,3053..3115) /note="matches EST AA403072 from clone IMAGE:758347" misc_feature join(2739..3054,3050..3143) /note="matches EST AA232787 from clone IMAGE:666656" misc_feature join(2757..2884,2881..3023) /note="matches EST N40351 from clone IMAGE:269966" misc_feature complement(join(2794..2876,2894..2935,2935..3045, 3046..3138,3135..3249)) /note="matches EST AA007344 from clone IMAGE:429263" misc_feature complement(2796..3249) /note="matches EST AI334230 from clone IMAGE:1932055" misc_feature 2808..2999 /note="matches EST N44116 from clone IMAGE:272953" misc_feature complement(join(2810..3045,3046..3250)) /note="matches EST AI082631 from clone IMAGE:1660573" misc_feature complement(join(2810..2885,2911..2935,3091..3250)) /note="matches EST N27535 from clone IMAGE:269966" misc_feature complement(join(2818..3045,3046..3092,3091..3249)) /note="matches EST N36110 from clone IMAGE:272953" misc_feature complement(join(2905..3045,3046..3138,3135..3249)) /note="matches EST AA489618 from clone IMAGE:823660" misc_feature complement(join(2918..3045,3046..3138,3135..3250)) /note="matches EST AA233364 from clone IMAGE:666656" misc_feature complement(3040..3549) /note="matches EST AW298226 from clone IMAGE:2733069" misc_feature join(3212..3478,3540..3563) /note="matches EST W38959 from clone IMAGE:304871" misc_feature complement(3397..3974) /note="matches EST AA628914 from clone IMAGE:1032940" misc_feature 3402..3738 /note="matches EST C04258 from clone 3NHC3019" misc_feature 3459..3877 /note="matches EST AA134031 from clone IMAGE:503848" misc_feature join(3459..3633,3633..3656) /note="matches EST AA045035 from clone IMAGE:488780" misc_feature join(3542..3710,3754..3948) /note="matches EST W39026 from clone IMAGE:305523" misc_feature complement(3576..4126) /note="matches EST AI042706 from clone IMAGE:1431595" misc_feature complement(join(3596..3619,3642..4038)) /note="matches EST AA115737 from clone IMAGE:490637" misc_feature join(3596..3809,3798..4045) /note="matches EST AA133497 from clone IMAGE:490637" misc_feature complement(3597..4126) /note="matches EST AI041537 from clone IMAGE:1643803" misc_feature complement(3608..3974) /note="matches EST AI088144 from clone IMAGE:1683131" misc_feature complement(3625..4126) /note="matches EST AA404352 from clone IMAGE:758347" misc_feature complement(join(3626..3645,3674..3898,3867..4126)) /note="matches EST AA133966 from clone IMAGE:503848" misc_feature complement(join(3642..3898,3877..4122)) /note="matches EST AW973035" misc_feature complement(join(3685..3898,3867..4126)) /note="matches EST AI081145 from clone IMAGE:1680293" misc_feature complement(join(3689..3898,3867..4126)) /note="matches EST AI753293 from clone HBMSC_cr08b03" misc_feature complement(join(3694..3898,3867..4123)) /note="matches EST AI097288 from clone IMAGE:1707216" misc_feature complement(3727..4126) /note="matches EST AI292321 from clone IMAGE:1894742" misc_feature complement(join(3737..3898,3867..4126)) /note="matches EST AI753932 from clone HBMSC_cr16c08" misc_feature complement(join(3774..3898,3867..4126)) /note="matches EST AI277131 from clone IMAGE:1893578" misc_feature complement(3793..4126) /note="matches EST N93207 from clone IMAGE:304871" misc_feature complement(3795..4124) /note="matches EST AI289525 from clone IMAGE:1992441" misc_feature complement(join(3795..3887,3877..4017,4005..4126)) /note="matches EST AW103571 from clone IMAGE:2614034" misc_feature complement(3867..4123) /note="matches EST AA532534 from clone IMAGE:986291" misc_feature complement(3867..4125) /note="matches EST AW166863 from clone IMAGE:2634465" misc_feature complement(3867..4126) /note="matches EST AI753418 from clone HBMSC_cr10b04" misc_feature complement(3945..4126) /note="matches EST AI240819 from clone IMAGE:1848499" BASE COUNT 914 a 1066 c 979 g 1167 t ORIGIN 1 cgctcgccat gggccactcc ccacctgtcc tgcctttgtg tgcctctgtg tctttgctgg 61 gtggcctgac ctttggttat gaactggcag tcatatcagg tgccctgctg ccactgcagc 121 ttgactttgg gctaagctgc ttggagcagg agttcctggt gggcagcctg ctcctggggg 181 ctctcctcgc ctccctggtt ggtggcttcc tcattgactg ctatggcagg aagcaagcca 241 tcctcgggag caacttggtg ctgctggcag gcagcctgac cctgggcctg gctggttccc 301 tggcctggct ggtcctgggc cgcgctgtgg ttggcttcgc catttccctc tcctccatgg 361 cttgctgtat ctacgtgtca gagctggtgg ggccacggca gcggggagtg ctggtgtccc 421 tctatgaggc aggcatcacc gtgggcatcc tgctctccta tgccctcaac tatgcactgg 481 ctggtacccc ctggggatgg aggcacatgt tcggctgggc cactgcacct gctgtcctgc 541 aatccctcag cctcctcttc ctccctgctg gtacagatga gactgcaaca cacaaggacc 601 tcatcccact ccagggaggt gaggccccca agctgggccc ggggaggcca cggtactcct 661 ttctggacct cttcagggca cgcgataaca tgcgaggccg gaccacagtg ggcctggggc 721 tggtgctctt ccagcaacta acagggcagc ccaacgtgct gtgctatgcc tccaccatct 781 tcagctccgt tggtttccat gggggatcct cagccgtgct ggcctctgtg gggcttggcg 841 cagtgaaggt ggcagctacc ctgaccgcca tggggctggt ggaccgtgca ggccgcaggg 901 ctctgttgct agctggctgt gccctcatgg ccctgtccgt cagtggcata ggcctcgtca 961 gctttgccgt gcccatggac tcaggcccaa gctgtctggc tgtgcccaat gccaccgggc 1021 agacaggcct ccctggagac tctggcctgc tgcaggactc ctctctacct cccattccaa 1081 ggaccaatga ggaccaaagg gagccaatct tgtccactgc taagaaaacc aagccccatc 1141 ccagatctgg agacccctca gcccctcctc ggctggccct gagctctgcc ctccctgggc 1201 cccctctgcc cgctcggggg catgcactgc tgcgctggac cgcactgctg tgcctgatgg 1261 tctttgtcag tgccttctcc tttgggtttg ggccagtgac ctggcttgtc ctcagcgaga 1321 tctaccctgt ggagatacga ggaagagcct tcgccttctg caacagcttc aactgggcgg 1381 ccaacctctt catcagcctc tccttcctcg atctcattgg caccatcggc ttgtcctgga 1441 ccttcctgct ctacggactg accgctgtcc tcggcctggg cttcatctat ttatttgttc 1501 ctgaaacaaa aggccagtcg ttggcagaga tagaccagca gttccagaag agacggttca 1561 ccctgagctt tggccacagg cagaactcca ctggcatccc gtacagccgc atcgagatct 1621 ctgcggcctc ctgaggaatc cgtctgcctg gaaattctgg aactgtggct ttggcagacc 1681 atctccagca tcctgcttcc taggccccag agcacaagtt ccagctggtc ttttgggagt 1741 ggcccctgcc cccaaaggtg gtctgctttt gctggggtaa aaaggatgaa agtctgagaa 1801 tgcccaactc ttcattttga gtctcaggcc ctgaaggttc ctgaggatct agcttcatgc 1861 ctcagtttcc ccattgactt gcacatctct gcagtattta taagaagaat attctatgaa 1921 gtctttgttg caccatggac ttttctcaaa gaatctcaag ggtaccaatc ctggcaggaa 1981 gtctctcccg atatcacccc taaatccaaa tgaggatatc atcttttcta atctcttttt 2041 tcaactggct gggacatttt cggaaggggg aagtctcttt ttttactctt atcatttttt 2101 ttttttgagg tggagtctca ttctgttgcc caggctggcc tgatcttggc tcactgcaac 2161 ctccacctcc tgagttcaag cgattcttgt gcctcagcct cctaagcagc tgggactaca 2221 ggcgcatgca accataccca gctaatttat ttttagcaga gatggggttt cactgtgttg 2281 gccaggctgg tcgtgaactc ctgagctcaa gtgatccacc cacctcagcc tcccagagtg 2341 ctaggattac aggccttttg actcttttat ctgagtttta ttgacccctc taattctctt 2401 acccagaata tttatccttc accagcaact ctgactcttt gacgggaggc ctcagttcta 2461 gtccttggtc tgctggtgtc attgctgtag gaatgaccac gggcctcagt ttccccattt 2521 gtataatggg aagcctgtac caggtcattc ttaagatttc tcctgactcc agtgagctgg 2581 aattctaaat gctggtctag gagctgtctc caggatggtg caggatggct ttgcggaaag 2641 gagatgggtt tggaggccaa caaacctgct tgtcaatatt gcctttgcct cttggcagcc 2701 cttgaacttg agtaaataac aactccctga acctcagttt cctcatctgc agaatgggga 2761 taattatgtc ccaggggtat atttagaccc tgtttccttt caggagggtc cccagctggt 2821 ccagggcctg ggaaatttct acttatcctc attacccagg tccctccttt ggaccctgta 2881 aagggtcagg gtgaatcaga tgggggactg agcaagtagc tatgactgca gatcatgtaa 2941 ggaagggact gacaagaagc tcccagatgc tggggagaat gaagagctaa aatagatcct 3001 aggtgctgga tgctttgtca tccatgcgtg cacatatggg tgctggcaga gcccccaagg 3061 actctggcct ctcgagttct cctatcttct ccattctaga tgcttccctt gtatccagtg 3121 atgtgctgga gctggctttg ccaagcttgt gagagctggt tgctacattt tcaggatttt 3181 tacaagttgg taaacacagc cattataaaa aattaaatga tttaaattta taattaagta 3241 aattacatta aaacaaaaaa attatactca aaattcatta cttaatttta ctacctgtta 3301 ctattatctg tgcttttgag gctatttcta catagtaact cttatggaga cctaggggag 3361 acaccgcgca tctcttcctg attccccact caatgacatc atgttagtct ttggttgctt 3421 aactggctgt ggggagtgtt tttgtatcac aaagattaga gaggactaca catcagggct 3481 tgatttattg tttgttgatt ttctagactt cagaacatgc tggataaaat gtcagtaatg 3541 caaattaaac tttaaagtat gtcttgtttg tagccaatac atggtgtata gcaccaaaaa 3601 atggagggat tattcttcca gtagttgaac actgtcatcc gtttcagctg acagctgctc 3661 aaatcattta agaaggagtt ctgacattca ttttcattgt tttacttttg tcttcctcac 3721 tagtgtaaac aaaaatttca accagcattc atgccgaacc tatacccatt cttcagtgcc 3781 tagctgtaca gttatcaggg atttttattt gtagtctaat tttgtcaaat catggccaaa 3841 tcgcagtgat agttgacttt ggatacaagg tttggcaaaa aaaaaaatat taacaaaata 3901 ttctgtaaga atcaattgtc tatatggaat ttaggataaa gaatatttac aataaagaat 3961 atttacaata aagagtttat tattatttgt aagttgtgtg caacaaacat accctttatc 4021 tctgtaaaat ttatacacac aaaaattaac aaaagattct gtaagaatta attggctata 4081 tggaatttag gatagaatat ttacaataaa gagtatttac aataaa //