LOCUS       AL137188                4126 bp    mRNA    linear   HUM 15-OCT-2008
DEFINITION  Novel human gene mapping to chromosome 20, similar to membrane
            transporters.
ACCESSION   AL137188
VERSION     AL137188.3
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 4126)
  AUTHORS   Stavrides G.S., Hashim Y., Huckle E.J., Deloukas P.
  JOURNAL   Submitted (24-JAN-2000) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 28H20 (AL031055).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr20/
            Sanger Centre name : dJ28H20.C20.1
FEATURES             Location/Qualifiers
     source          1..4126
                     /db_xref="H-InvDB:HIT000250306"
                     /organism="Homo sapiens"
                     /chromosome="20"
                     /map="20q"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..12
                     /number=1
     CDS             9..1634
                     /product="hypothetical protein"
                     /db_xref="GOA:O95528"
                     /db_xref="H-InvDB:HIT000250306.14"
                     /db_xref="HGNC:HGNC:13444"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="InterPro:IPR036259"
                     /db_xref="UniProtKB/Swiss-Prot:O95528"
                     /protein_id="CAB69822.2"
                     /translation="MGHSPPVLPLCASVSLLGGLTFGYELAVISGALLPLQLDFGLSC
                     LEQEFLVGSLLLGALLASLVGGFLIDCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLV
                     LGRAVVGFAISLSSMACCIYVSELVGPRQRGVLVSLYEAGITVGILLSYALNYALAGT
                     PWGWRHMFGWATAPAVLQSLSLLFLPAGTDETATHKDLIPLQGGEAPKLGPGRPRYSF
                     LDLFRARDNMRGRTTVGLGLVLFQQLTGQPNVLCYASTIFSSVGFHGGSSAVLASVGL
                     GAVKVAATLTAMGLVDRAGRRALLLAGCALMALSVSGIGLVSFAVPMDSGPSCLAVPN
                     ATGQTGLPGDSGLLQDSSLPPIPRTNEDQREPILSTAKKTKPHPRSGDPSAPPRLALS
                     SALPGPPLPARGHALLRWTALLCLMVFVSAFSFGFGPVTWLVLSEIYPVEIRGRAFAF
                     CNSFNWAANLFISLSFLDLIGTIGLSWTFLLYGLTAVLGLGFIYLFVPETKGQSLAEI
                     DQQFQKRRFTLSFGHRQNSTGIPYSRIEISAAS"
     exon            13..1296
                     /number=2
     exon            1297..1419
                     /number=3
     misc_feature    1338..1643
                     /note="matches EST AA313045"
     exon            1420..1555
                     /number=4
     exon            1556..4126
                     /number=5
     misc_feature    2095..2137
                     /note="matches EST AA714011 from clone IMAGE:1240821"
     misc_feature    complement(2142..2172)
                     /note="matches EST BE747194 from clone IMAGE:3929520"
     misc_feature    join(2274..2544,2548..2589,2646..2763)
                     /note="matches EST AA007343 from clone IMAGE:429263"
     misc_feature    complement(2311..2352)
                     /note="matches EST AV650272 from clone GLCCDA12"
                     /note="matches EST AV650673 from clone GLCCHC08"
                     /note="matches EST AV650603 from clone GLCCGE10"
                     /note="matches EST AV650406 from clone GLCCEE02"
                     /note="matches EST AV650686 from clone GLCCHD09"
     misc_feature    join(2417..2711,2711..2814,3001..3029)
                     /note="matches EST W02942 from clone IMAGE:291802"
     misc_feature    2475..2804
                     /note="matches EST W31922 from clone IMAGE:320524"
     misc_feature    join(2476..2695,2693..2817)
                     /note="matches EST AA489718 from clone IMAGE:823660"
     misc_feature    join(2647..2694,2693..3059,3053..3115)
                     /note="matches EST AA403072 from clone IMAGE:758347"
     misc_feature    join(2739..3054,3050..3143)
                     /note="matches EST AA232787 from clone IMAGE:666656"
     misc_feature    join(2757..2884,2881..3023)
                     /note="matches EST N40351 from clone IMAGE:269966"
     misc_feature    complement(join(2794..2876,2894..2935,2935..3045,
                     3046..3138,3135..3249))
                     /note="matches EST AA007344 from clone IMAGE:429263"
     misc_feature    complement(2796..3249)
                     /note="matches EST AI334230 from clone IMAGE:1932055"
     misc_feature    2808..2999
                     /note="matches EST N44116 from clone IMAGE:272953"
     misc_feature    complement(join(2810..3045,3046..3250))
                     /note="matches EST AI082631 from clone IMAGE:1660573"
     misc_feature    complement(join(2810..2885,2911..2935,3091..3250))
                     /note="matches EST N27535 from clone IMAGE:269966"
     misc_feature    complement(join(2818..3045,3046..3092,3091..3249))
                     /note="matches EST N36110 from clone IMAGE:272953"
     misc_feature    complement(join(2905..3045,3046..3138,3135..3249))
                     /note="matches EST AA489618 from clone IMAGE:823660"
     misc_feature    complement(join(2918..3045,3046..3138,3135..3250))
                     /note="matches EST AA233364 from clone IMAGE:666656"
     misc_feature    complement(3040..3549)
                     /note="matches EST AW298226 from clone IMAGE:2733069"
     misc_feature    join(3212..3478,3540..3563)
                     /note="matches EST W38959 from clone IMAGE:304871"
     misc_feature    complement(3397..3974)
                     /note="matches EST AA628914 from clone IMAGE:1032940"
     misc_feature    3402..3738
                     /note="matches EST C04258 from clone 3NHC3019"
     misc_feature    3459..3877
                     /note="matches EST AA134031 from clone IMAGE:503848"
     misc_feature    join(3459..3633,3633..3656)
                     /note="matches EST AA045035 from clone IMAGE:488780"
     misc_feature    join(3542..3710,3754..3948)
                     /note="matches EST W39026 from clone IMAGE:305523"
     misc_feature    complement(3576..4126)
                     /note="matches EST AI042706 from clone IMAGE:1431595"
     misc_feature    complement(join(3596..3619,3642..4038))
                     /note="matches EST AA115737 from clone IMAGE:490637"
     misc_feature    join(3596..3809,3798..4045)
                     /note="matches EST AA133497 from clone IMAGE:490637"
     misc_feature    complement(3597..4126)
                     /note="matches EST AI041537 from clone IMAGE:1643803"
     misc_feature    complement(3608..3974)
                     /note="matches EST AI088144 from clone IMAGE:1683131"
     misc_feature    complement(3625..4126)
                     /note="matches EST AA404352 from clone IMAGE:758347"
     misc_feature    complement(join(3626..3645,3674..3898,3867..4126))
                     /note="matches EST AA133966 from clone IMAGE:503848"
     misc_feature    complement(join(3642..3898,3877..4122))
                     /note="matches EST AW973035"
     misc_feature    complement(join(3685..3898,3867..4126))
                     /note="matches EST AI081145 from clone IMAGE:1680293"
     misc_feature    complement(join(3689..3898,3867..4126))
                     /note="matches EST AI753293 from clone HBMSC_cr08b03"
     misc_feature    complement(join(3694..3898,3867..4123))
                     /note="matches EST AI097288 from clone IMAGE:1707216"
     misc_feature    complement(3727..4126)
                     /note="matches EST AI292321 from clone IMAGE:1894742"
     misc_feature    complement(join(3737..3898,3867..4126))
                     /note="matches EST AI753932 from clone HBMSC_cr16c08"
     misc_feature    complement(join(3774..3898,3867..4126))
                     /note="matches EST AI277131 from clone IMAGE:1893578"
     misc_feature    complement(3793..4126)
                     /note="matches EST N93207 from clone IMAGE:304871"
     misc_feature    complement(3795..4124)
                     /note="matches EST AI289525 from clone IMAGE:1992441"
     misc_feature    complement(join(3795..3887,3877..4017,4005..4126))
                     /note="matches EST AW103571 from clone IMAGE:2614034"
     misc_feature    complement(3867..4123)
                     /note="matches EST AA532534 from clone IMAGE:986291"
     misc_feature    complement(3867..4125)
                     /note="matches EST AW166863 from clone IMAGE:2634465"
     misc_feature    complement(3867..4126)
                     /note="matches EST AI753418 from clone HBMSC_cr10b04"
     misc_feature    complement(3945..4126)
                     /note="matches EST AI240819 from clone IMAGE:1848499"
BASE COUNT          914 a         1066 c          979 g         1167 t
ORIGIN      
        1 cgctcgccat gggccactcc ccacctgtcc tgcctttgtg tgcctctgtg tctttgctgg
       61 gtggcctgac ctttggttat gaactggcag tcatatcagg tgccctgctg ccactgcagc
      121 ttgactttgg gctaagctgc ttggagcagg agttcctggt gggcagcctg ctcctggggg
      181 ctctcctcgc ctccctggtt ggtggcttcc tcattgactg ctatggcagg aagcaagcca
      241 tcctcgggag caacttggtg ctgctggcag gcagcctgac cctgggcctg gctggttccc
      301 tggcctggct ggtcctgggc cgcgctgtgg ttggcttcgc catttccctc tcctccatgg
      361 cttgctgtat ctacgtgtca gagctggtgg ggccacggca gcggggagtg ctggtgtccc
      421 tctatgaggc aggcatcacc gtgggcatcc tgctctccta tgccctcaac tatgcactgg
      481 ctggtacccc ctggggatgg aggcacatgt tcggctgggc cactgcacct gctgtcctgc
      541 aatccctcag cctcctcttc ctccctgctg gtacagatga gactgcaaca cacaaggacc
      601 tcatcccact ccagggaggt gaggccccca agctgggccc ggggaggcca cggtactcct
      661 ttctggacct cttcagggca cgcgataaca tgcgaggccg gaccacagtg ggcctggggc
      721 tggtgctctt ccagcaacta acagggcagc ccaacgtgct gtgctatgcc tccaccatct
      781 tcagctccgt tggtttccat gggggatcct cagccgtgct ggcctctgtg gggcttggcg
      841 cagtgaaggt ggcagctacc ctgaccgcca tggggctggt ggaccgtgca ggccgcaggg
      901 ctctgttgct agctggctgt gccctcatgg ccctgtccgt cagtggcata ggcctcgtca
      961 gctttgccgt gcccatggac tcaggcccaa gctgtctggc tgtgcccaat gccaccgggc
     1021 agacaggcct ccctggagac tctggcctgc tgcaggactc ctctctacct cccattccaa
     1081 ggaccaatga ggaccaaagg gagccaatct tgtccactgc taagaaaacc aagccccatc
     1141 ccagatctgg agacccctca gcccctcctc ggctggccct gagctctgcc ctccctgggc
     1201 cccctctgcc cgctcggggg catgcactgc tgcgctggac cgcactgctg tgcctgatgg
     1261 tctttgtcag tgccttctcc tttgggtttg ggccagtgac ctggcttgtc ctcagcgaga
     1321 tctaccctgt ggagatacga ggaagagcct tcgccttctg caacagcttc aactgggcgg
     1381 ccaacctctt catcagcctc tccttcctcg atctcattgg caccatcggc ttgtcctgga
     1441 ccttcctgct ctacggactg accgctgtcc tcggcctggg cttcatctat ttatttgttc
     1501 ctgaaacaaa aggccagtcg ttggcagaga tagaccagca gttccagaag agacggttca
     1561 ccctgagctt tggccacagg cagaactcca ctggcatccc gtacagccgc atcgagatct
     1621 ctgcggcctc ctgaggaatc cgtctgcctg gaaattctgg aactgtggct ttggcagacc
     1681 atctccagca tcctgcttcc taggccccag agcacaagtt ccagctggtc ttttgggagt
     1741 ggcccctgcc cccaaaggtg gtctgctttt gctggggtaa aaaggatgaa agtctgagaa
     1801 tgcccaactc ttcattttga gtctcaggcc ctgaaggttc ctgaggatct agcttcatgc
     1861 ctcagtttcc ccattgactt gcacatctct gcagtattta taagaagaat attctatgaa
     1921 gtctttgttg caccatggac ttttctcaaa gaatctcaag ggtaccaatc ctggcaggaa
     1981 gtctctcccg atatcacccc taaatccaaa tgaggatatc atcttttcta atctcttttt
     2041 tcaactggct gggacatttt cggaaggggg aagtctcttt ttttactctt atcatttttt
     2101 ttttttgagg tggagtctca ttctgttgcc caggctggcc tgatcttggc tcactgcaac
     2161 ctccacctcc tgagttcaag cgattcttgt gcctcagcct cctaagcagc tgggactaca
     2221 ggcgcatgca accataccca gctaatttat ttttagcaga gatggggttt cactgtgttg
     2281 gccaggctgg tcgtgaactc ctgagctcaa gtgatccacc cacctcagcc tcccagagtg
     2341 ctaggattac aggccttttg actcttttat ctgagtttta ttgacccctc taattctctt
     2401 acccagaata tttatccttc accagcaact ctgactcttt gacgggaggc ctcagttcta
     2461 gtccttggtc tgctggtgtc attgctgtag gaatgaccac gggcctcagt ttccccattt
     2521 gtataatggg aagcctgtac caggtcattc ttaagatttc tcctgactcc agtgagctgg
     2581 aattctaaat gctggtctag gagctgtctc caggatggtg caggatggct ttgcggaaag
     2641 gagatgggtt tggaggccaa caaacctgct tgtcaatatt gcctttgcct cttggcagcc
     2701 cttgaacttg agtaaataac aactccctga acctcagttt cctcatctgc agaatgggga
     2761 taattatgtc ccaggggtat atttagaccc tgtttccttt caggagggtc cccagctggt
     2821 ccagggcctg ggaaatttct acttatcctc attacccagg tccctccttt ggaccctgta
     2881 aagggtcagg gtgaatcaga tgggggactg agcaagtagc tatgactgca gatcatgtaa
     2941 ggaagggact gacaagaagc tcccagatgc tggggagaat gaagagctaa aatagatcct
     3001 aggtgctgga tgctttgtca tccatgcgtg cacatatggg tgctggcaga gcccccaagg
     3061 actctggcct ctcgagttct cctatcttct ccattctaga tgcttccctt gtatccagtg
     3121 atgtgctgga gctggctttg ccaagcttgt gagagctggt tgctacattt tcaggatttt
     3181 tacaagttgg taaacacagc cattataaaa aattaaatga tttaaattta taattaagta
     3241 aattacatta aaacaaaaaa attatactca aaattcatta cttaatttta ctacctgtta
     3301 ctattatctg tgcttttgag gctatttcta catagtaact cttatggaga cctaggggag
     3361 acaccgcgca tctcttcctg attccccact caatgacatc atgttagtct ttggttgctt
     3421 aactggctgt ggggagtgtt tttgtatcac aaagattaga gaggactaca catcagggct
     3481 tgatttattg tttgttgatt ttctagactt cagaacatgc tggataaaat gtcagtaatg
     3541 caaattaaac tttaaagtat gtcttgtttg tagccaatac atggtgtata gcaccaaaaa
     3601 atggagggat tattcttcca gtagttgaac actgtcatcc gtttcagctg acagctgctc
     3661 aaatcattta agaaggagtt ctgacattca ttttcattgt tttacttttg tcttcctcac
     3721 tagtgtaaac aaaaatttca accagcattc atgccgaacc tatacccatt cttcagtgcc
     3781 tagctgtaca gttatcaggg atttttattt gtagtctaat tttgtcaaat catggccaaa
     3841 tcgcagtgat agttgacttt ggatacaagg tttggcaaaa aaaaaaatat taacaaaata
     3901 ttctgtaaga atcaattgtc tatatggaat ttaggataaa gaatatttac aataaagaat
     3961 atttacaata aagagtttat tattatttgt aagttgtgtg caacaaacat accctttatc
     4021 tctgtaaaat ttatacacac aaaaattaac aaaagattct gtaagaatta attggctata
     4081 tggaatttag gatagaatat ttacaataaa gagtatttac aataaa
//