LOCUS AL136660 690 bp mRNA linear HTC 15-OCT-2008
DEFINITION Homo sapiens mRNA; cDNA DKFZp564J1864 (from clone DKFZp564J1864).
ACCESSION AL136660
VERSION AL136660.1
KEYWORDS HTC.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 690)
AUTHORS Bahr A., Lauber J., Mewes H.W., Weil B., Amid C., Osanger A.,
Fobo G., Han M., Wiemann S.
CONSRTM The German cDNA Consortium
JOURNAL Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
Research
Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
sequenced by Qiagen (Hilden/Germany) within the cDNA sequencing
consortium of the German Genome Project.
This clone (DKFZp564J1864) is available at the RZPD Deutsches
Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
Please contact RZPD for ordering:
http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp564J1864
Further information about the clone and the sequencing project is
available at http://mips.gsf.de/projects/cdna/
FEATURES Location/Qualifiers
source 1..690
/db_xref="H-InvDB:HIT000025256"
/organism="Homo sapiens"
/mol_type="mRNA"
/dev_stage="fetal"
/clone_lib="564 (synonym: hfbr2). Vector pAMP1; host
Xl-2blue; sites NotI + SalI"
/clone="DKFZp564J1864"
/tissue_type="brain"
/note="hypothetical protein"
/db_xref="taxon:9606"
CDS 109..651
/codon_start=1
/gene="DKFZp564J1864"
/product="hypothetical protein"
/db_xref="GOA:P61009"
/db_xref="H-InvDB:HIT000025256.15"
/db_xref="HGNC:HGNC:26212"
/db_xref="InterPro:IPR007653"
/db_xref="UniProtKB/Swiss-Prot:P61009"
/protein_id="CAB66595.1"
/translation="MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVS
RIMLKNVEDFTGPRERSDLGFITSDITADLENIFDWNVKQLFLYLSAEYSTKNNALNQ
VVLWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLV
TGSGHVSVPFPDTYEITKSY"
BASE COUNT 201 a 145 c 174 g 170 t
ORIGIN
1 gccggaacgc gcgcaccgca gacggcgcgg atcgcaggga gccggtccgc cgccggaacg
61 ggagcctggg tgtgcgtgtg gagtccggac tcgtgggaga cgatcgcgat gaacacggtg
121 ctgtcgcggg cgaactcact gttcgccttc tcgctgagcg tgatggcggc gctcaccttc
181 ggctgcttca tcaccaccgc cttcaaagac aggagcgtcc cggtgcggct gcacgtctcg
241 cggatcatgc taaaaaatgt agaagatttc actggaccta gagaaagaag tgatctggga
301 tttatcacat ctgatataac tgctgatcta gagaatatat ttgattggaa tgttaagcag
361 ttgtttcttt atttatcagc agaatattca acaaaaaata atgctctgaa ccaagttgtc
421 ctatgggaca agattgtttt gagaggtgat aatccgaagc tgctgctgaa agatatgaaa
481 acaaaatatt ttttctttga cgatggaaat ggtctcaagg gaaacaggaa tgtcactttg
541 accctgtctt ggaacgtcgt accaaatgct ggaattctac ctcttgtgac aggatcagga
601 cacgtatctg tcccatttcc agatacatat gaaataacga agagttatta aattattctg
661 aatttgaaac aaaaaaaaaa aaaaaaaaaa
//