LOCUS AL133001 1729 bp mRNA linear HUM 14-NOV-2006
DEFINITION Novel human gene on chromosome 20, similar to
GLUCOSAMINE-6-SULFATASES.
ACCESSION AL133001
VERSION AL133001.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1729)
AUTHORS Stavrides G.S., Huckle E.J., Deloukas P.
JOURNAL Submitted (16-NOV-1999) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This partial cDNA sequence was assembled from public domain ESTs
and
single pass sequencing reads from expressed DNA templates, aligned
to
the genomic DNA sequence from the bacterial clone 1049G16
(AL034418).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr20/
Sanger Centre name : dJ1049G16.1
FEATURES Location/Qualifiers
source 1..1729
/db_xref="H-InvDB:HIT000250286"
/organism="Homo sapiens"
/chromosome="20"
/map="20q12-13.2"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..227
/number=1
misc_feature join(1..81,84..247)
/note="matches EST AA295197"
misc_feature join(1..132,129..313)
/note="matches EST N39498 from clone 256937"
misc_feature join(165..363,359..396)
/note="matches EST AA332792"
misc_feature 170..465
/note="matches EST AA323130"
exon 228..324
/number=2
exon 325..419
/number=3
misc_feature join(333..595,592..645,644..667,665..691)
/note="matches EST R14440 from clone 28714"
exon 420..479
/number=4
exon 480..649
/number=5
misc_feature join(529..794,816..886)
/note="matches EST AA294950"
misc_feature complement(548..941)
/note="matches EST AA612659 from clone IMAGE:1144906"
CDS 586..1035
/product="hypothetical protein"
/db_xref="GOA:Q8IWU5"
/db_xref="H-InvDB:HIT000250286.11"
/db_xref="HGNC:HGNC:20392"
/db_xref="InterPro:IPR000917"
/db_xref="InterPro:IPR014615"
/db_xref="InterPro:IPR017850"
/db_xref="InterPro:IPR024607"
/db_xref="InterPro:IPR024609"
/db_xref="UniProtKB/Swiss-Prot:Q8IWU5"
/protein_id="CAB61349.1"
/translation="MPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINE
THNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCN
PRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG"
exon 650..792
/number=6
misc_feature join(685..917,915..934)
/note="matches EST AA304723"
misc_feature 764..845
/note="matches EST AA506790 from clone DEME-43"
misc_feature join(769..917,915..978)
/note="matches EST C00596"
exon 793..916
/number=7
exon 917..950
/number=8
exon 951..1004
/number=9
exon 1005..1729
/number=10
misc_feature 1034..1303
/note="matches EST AA347026"
misc_feature 1077..1408
/note="matches EST R91358 from clone 195221"
misc_feature complement(join(1154..1456,1450..1729))
/note="matches EST AI688582 from clone IMAGE:2330559"
misc_feature complement(1222..1729)
/note="matches EST AA777773 from clone 448573"
misc_feature complement(1231..1725)
/note="matches EST AA703884 from clone 1140670"
misc_feature 1248..1420
/note="matches EST T24948 from clone 18H4"
misc_feature complement(1250..1725)
/note="matches EST AI972020 from clone IMAGE:2531159"
misc_feature complement(1268..1729)
/note="matches EST AA916666 from clone IMAGE:1473844"
misc_feature complement(1281..1728)
/note="matches EST AI356198 from clone IMAGE:2015803"
misc_feature complement(1284..1725)
/note="matches EST AA308054"
misc_feature complement(1293..1725)
/note="matches EST N26808 from clone 257033"
misc_feature complement(1295..1727)
/note="matches EST AW152059 from clone IMAGE:2623746"
misc_feature complement(1297..1419)
/note="matches EST AI985668 from clone IMAGE:2507938"
misc_feature complement(1311..1725)
/note="matches EST AW074054 from clone IMAGE:2575549"
misc_feature complement(1312..1729)
/note="matches EST AI694175 from clone IMAGE:2325266"
misc_feature 1333..1690
/note="matches EST AA043012 from clone 486874"
misc_feature complement(1336..1729)
/note="matches EST AI160378 from clone IMAGE:1721496"
misc_feature complement(1344..1728)
/note="matches EST AA865313 from clone IMAGE:1455343"
misc_feature complement(1360..1726)
/note="matches EST AI040102 from clone IMAGE:1655744"
misc_feature complement(1361..1729)
/note="matches EST AI872785 from clone IMAGE:2441322"
misc_feature complement(1362..1729)
/note="matches EST AI632877 from clone IMAGE:2287307"
misc_feature complement(1397..1729)
/note="matches EST AI207271 from clone IMAGE:1758969"
misc_feature complement(1428..1729)
/note="matches EST AA226793 from clone 663825"
misc_feature complement(1435..1729)
/note="matches EST AW084196 from clone IMAGE:2587958"
misc_feature 1479..1729
/note="matches EST H49126 from clone 178598"
BASE COUNT 522 a 436 c 435 g 336 t
ORIGIN
1 tacaaggcca gctatgtccg cagtcgctcc atccgctcag tggccatcga ggtggacggc
61 agggtgtacc acgtaggcct gggtgatgcc gcccagcccc gaaacctcac caagcggcac
121 tggccagggg cccctgagga ccaagatgac aaggatggtg gggacttcag tggcactgga
181 ggccttcccg actactcagc cgccaacccc attaaagtga cacatcggtg ctacatccta
241 gagaacgaca cagtccagtg tgacctggac ctgtacaagt ccctgcaggc ctggaaagac
301 cacaagctgc acatcgacca cgagattgaa accctgcaga acaaaattaa gaacctgagg
361 gaagtccgag gtcacctgaa gaaaaagcgg ccagaagaat gtgactgtca caaaatcagc
421 taccacaccc agcacaaagg ccgcctcaag cacagaggct ccagtctgca tcctttcagg
481 aagggcctgc aagagaagga caaggtgtgg ctgttgcggg agcagaagcg caagaagaaa
541 ctccgcaagc tgctcaagcg cctgcagaac aacgacacgt gcagcatgcc aggcctcacg
601 tgcttcaccc acgacaacca gcactggcag acggcgcctt tctggacact ggggcctttc
661 tgtgcctgca ccagcgccaa caataacacg tactggtgca tgaggaccat caatgagact
721 cacaatttcc tcttctgtga atttgcaact ggcttcctag agtactttga tctcaacaca
781 gacccctacc agctgatgaa tgcagtgaac acactggaca gggatgtcct caaccagcta
841 cacgtacagc tcatggagct gaggagctgc aagggttaca agcagtgtaa cccccggact
901 cgaaacatgg acctgggact taaagatgga ggaagctatg agcaatacag gcagtttcag
961 cgtcgaaagt ggccagaaat gaagagacct tcttccaaat cactgggaca actgtgggaa
1021 ggctgggaag gttaagaaac aacagaggtg gacctccaaa aacatagagg catcacctga
1081 ctgcacaggc aatgaaaaac catgtgggtg atttccagca gacctgtggt attggccagg
1141 aggcctgaga aagcaagcac gcactctcag tcaacatgac agattctgga ggataaccag
1201 caggagcaga gataacttca ggaagtccat ttttgcccct gcttttgctt tggattatac
1261 ctcaccagct gcacaaaatg cattttttcg tatcaaaaag tcaccactaa ccctccccca
1321 gaagctcaca aaggaaaacg gagagagcga gcgagagaga tttccttgga aatttctccc
1381 aagggcgaaa gtcattggaa tttttaaatc ataggggaaa agcagtcctg ttctaaatcc
1441 tcttattctt ttggtttgtc acaaagaagg aactaagaag caggacagag gcaacgtgga
1501 gaggctgaaa acagtgcaga gacgtttgac aatgagtcag tagcacaaaa gagatgacat
1561 ttacctagca ctataaaccc tggttgcctc tgaagaaact gccttcattg tatatatgtg
1621 actatttaca tgtaatcaac atgggaactt ttaggggaac ctaataagaa atcccaattt
1681 tcaggagtgg tggtgtcaat aaacgctctg tggccagtgt aaaagaaaa
//