LOCUS AL121740 1749 bp mRNA linear HUM 15-OCT-2008
DEFINITION Novel human gene from chromosome 20, similar to S68401: cattle
glucose induced gene.
ACCESSION AL121740
VERSION AL121740.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1749)
AUTHORS Stavrides G.S., Huckle E.J., Deloukas P.
JOURNAL Submitted (04-OCT-1999) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the bacterial clone 1119D9 (AL031652).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr20/
Sanger Centre name : dJ1119D9.C20.1
FEATURES Location/Qualifiers
source 1..1749
/db_xref="H-InvDB:HIT000250280"
/organism="Homo sapiens"
/chromosome="20"
/map="p12"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..266
/number=1
misc_feature 1..350
/note="matches EST Z45051from clone c-2ff02"
CDS 203..1045
/product="hypothetical protein"
/db_xref="GOA:Q9UJQ1"
/db_xref="H-InvDB:HIT000250280.14"
/db_xref="HGNC:HGNC:16097"
/db_xref="InterPro:IPR002000"
/db_xref="UniProtKB/Swiss-Prot:Q9UJQ1"
/protein_id="CAB57330.1"
/translation="MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPE
KDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHS
QSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAG
KHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFV
FSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQY
KHMG"
misc_feature join(222..502,501..602,612..633)
/note="matches EST R52806from clone 41860"
exon 267..439
/number=2
exon 440..571
/number=3
misc_feature join(541..671,688..912)
/note="matches EST T19342from clone e07016"
exon 572..677
/number=4
exon 678..866
/number=5
misc_feature 709..1183
/note="matches EST W27660"
exon 867..1749
/number=6
misc_feature 1081..1460
/note="matches EST AI174219from clone IMAGE:1684323"
misc_feature complement(join(1139..1589,1592..1749))
/note="matches EST AA779683from clone 1034424"
misc_feature complement(1243..1736)
/note="matches EST AA778834from clone 452552"
misc_feature complement(join(1281..1631,1630..1749))
/note="matches EST AI609802from clone IMAGE:2105892"
misc_feature complement(1300..1749)
/note="matches EST AI860306from clone IMAGE:2423648"
misc_feature complement(1348..1749)
/note="matches EST AI380154from clone IMAGE:2106809"
misc_feature complement(join(1358..1414,1405..1631,1630..1749))
/note="matches EST AI422421from clone IMAGE:2104229"
misc_feature complement(join(1390..1590,1592..1749))
/note="matches EST N50668from clone 280814"
misc_feature complement(join(1392..1415,1404..1662,1661..1748))
/note="matches EST R44985from clone 34442"
misc_feature complement(1426..1749)
/note="matches EST AA699401from clone 433234"
misc_feature complement(join(1433..1549,1550..1749))
/note="matches EST AI055953from clone IMAGE:1659200"
misc_feature complement(1435..1747)
/note="matches EST AI912462from clone IMAGE:2287731"
misc_feature complement(1477..1749)
/note="matches EST Z40782from clone c-2ff02"
misc_feature complement(1596..1749)
/note="matches EST AA716140from clone 397746"
BASE COUNT 428 a 470 c 435 g 416 t
ORIGIN
1 gatttgctct gccagcagct gtcggtgccg cgctcgacac cgagtcctag ctaggcgctc
61 acagaatacg cgctccctcc ctcccccttc tctgtccccc gcctctcgct caccccggcc
121 cactccagcg gcgactttga gggattccct ctctggcggc ctctgcagca gcacagccgg
181 cctcattcgg ggcactgcga gtatggatct ccaaggaaga ggggtcccca gcatcgacag
241 acttcgagtt ctcctgatgt tgttccatac aatggctcaa atcatggcag aacaagaagt
301 ggaaaatctc tcaggccttt ccactaaccc tgaaaaagat atatttgtgg tgcgggaaaa
361 tgggacgacg tgtctcatgg cagagtttgc agccaaattt attgtacctt atgatgtgtg
421 ggccagcaac tacgtagatc tgatcacaga acaggccgat atcgcattga cccggggagc
481 tgaggtgaag ggccgctgtg gccacagcca gtcggagctg caagtgttct gggtggatcg
541 cgcatatgca ctcaaaatgc tctttgtaaa ggaaagccac aacatgtcca agggacctga
601 ggcgacttgg aggctgagca aagtgcagtt tgtctacgac tcctcggaga aaacccactt
661 caaagacgca gtcagtgctg ggaagcacac agccaactcg caccacctct ctgccttggt
721 cacccccgct gggaagtcct atgagtgtca agctcaacaa accatttcac tggcctctag
781 tgatccgcag aagacggtca ccatgatcct gtctgcggtc cacatccaac cttttgacat
841 tatctcagat tttgtcttca gtgaagagca taaatgccca gtggatgagc gggagcaact
901 ggaagaaacc ttgcccctga ttttggggct catcttgggc ctcgtcatca tggtaacact
961 cgcgatttac cacgtccacc acaaaatgac tgccaaccag gtgcagatcc ctcgggacag
1021 atcccagtat aagcacatgg gctagaggcc gttaggcagg caccccctat tcctgctccc
1081 ccaactggat caggtagaac aacaaaagca cttttccatc ttgtacacga gatacaccaa
1141 catagctaca atcaaacagg cctgggtatc tgaggcttgc ttggcttgtg tccatgctta
1201 aacccacgga agggggagac tctttcggat ttgtagggtg aaatggcaat tattctctcc
1261 atgctgggga ggaggggagg agggtctcag acagctttcg tgctcatggt ggcttggctt
1321 tgactctcca aagagcaata aatgccactt ggagctgtat ctggccccaa agtttaggga
1381 ttgaaaacat gcttctttga ggaggaaacc cctttaggtt cagaagaata tggggtgctt
1441 tgctcccttg gacacagctg gcttatccta tacagttgtc aatgcacaca gaatacaacc
1501 tcatgctccc tgcagcaaga cccctgaaag tgattcatgc ttctggctgg cattctgcat
1561 gtttagtgat tgtcttggga atgtttcact gctacccgca tccagcgact gcagcaccag
1621 aaaacgacta atgtaactat gcagagttgt ttggacttct tcctgtgcca ggtccaagtc
1681 gggggacctg aagaatcaat ctgtgtgagt ctgtttttca aaatgaaata aaacacacta
1741 ttctctggc
//