LOCUS AL121733 3158 bp mRNA linear HUM 14-NOV-2006 DEFINITION Novel human gene mapping to chomosome 1. ACCESSION AL121733 VERSION AL121733.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3158) AUTHORS Rhodes S., Huckle E. JOURNAL Submitted (04-OCT-1999) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 126A5 (AL031447). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr1/ Partial, experimentally determined gene. Sanger Centre name : dJ126A5.C1.3 FEATURES Location/Qualifiers source 1..3158 /db_xref="H-InvDB:HIT000250274" /organism="Homo sapiens" /chromosome="1" /map="1p36.21-36.33" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..535 /number=1 misc_feature complement(1..426) /note="matches EST AI589556 from clone IMAGE:2162252" CDS <1..762 /product="hypothetical protein" /db_xref="GOA:Q86YI8" /db_xref="H-InvDB:HIT000250274.13" /db_xref="HGNC:HGNC:22983" /db_xref="InterPro:IPR001965" /db_xref="InterPro:IPR011011" /db_xref="InterPro:IPR013083" /db_xref="InterPro:IPR019787" /db_xref="InterPro:IPR041947" /db_xref="PDB:3O70" /db_xref="PDB:3O7A" /db_xref="UniProtKB/Swiss-Prot:Q86YI8" /protein_id="CAB57324.1" /translation="ELPLRSSPSPANSTAGTIDSDGWDAGFSDIASSVPLPVSDRCFS HLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYV ETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQV VFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRK SNVPEVFVCQKCRDSKFDIRRSNRSRTGSRKLFLD" exon 536..3158 /number=2 misc_feature complement(746..1184) /note="matches EST AI699367 from clone IMAGE:2301426" misc_feature complement(747..1184) /note="matches EST AI493109 from clone IMAGE:2030270" misc_feature 850..1251 /note="matches EST AL039383 from clone DKFZp434J0110" misc_feature complement(899..1184) /note="matches EST AI203840 from clone IMAGE:1755898" misc_feature complement(922..1184) /note="matches EST AA810639 from clone IMAGE:1335560" misc_feature join(1106..1264,1454..1476) /note="matches EST T78497 from clone 113362" misc_feature join(1210..1318,1511..1541) /note="matches EST AA143098 from clone 592148" misc_feature 2037..2361 /note="matches EST AA301263" misc_feature join(2060..2238,2225..2549) /note="matches EST AA234655 from clone 669274" misc_feature join(2071..2114,2257..2356) /note="matches EST AA243230 from clone 664521" misc_feature join(2134..2237,2437..2474) /note="matches EST R63138 from clone 137991" misc_feature join(2136..2256,2257..2568) /note="matches EST AA393513 from clone 728112" misc_feature complement(join(2300..2594,2594..2633)) /note="matches EST T78434 from clone 113362" misc_feature 2359..2676 /note="matches EST AA424611 from clone 767131" misc_feature join(2359..2694,2691..2714) /note="matches EST H56726 from clone 203893" misc_feature join(2395..2754,2754..2780) /note="matches EST R98531 from clone 201157" misc_feature 2396..2694 /note="matches EST T97087 from clone 121213" misc_feature 2396..2995 /note="matches EST AA203440 from clone 446534" misc_feature 2396..2645 /note="matches EST R08738 from clone 127829" misc_feature 2540..2584 /note="matches EST H26134 from clone 161540" misc_feature complement(2619..3113) /note="matches EST AL039384 from clone DKFZp434J0110" misc_feature complement(2623..3107) /note="matches EST AI633588 from clone IMAGE:2123869" misc_feature complement(join(2628..2991,2991..3113)) /note="matches EST AA749089 from clone IMAGE:1271413" misc_feature complement(2628..3113) /note="matches EST AA398641 from clone 728112" misc_feature 2628..2812 /note="matches EST H21791 from clone 160247" misc_feature 2628..2995 /note="matches EST AA418661 from clone 767377" misc_feature complement(2628..3102) /note="matches EST AI652643 from clone IMAGE:2307153" misc_feature complement(2628..3112) /note="matches EST AI652376 from clone IMAGE:2310103" misc_feature complement(2634..3122) /note="matches EST AA534923 from clone IMAGE:926075" misc_feature complement(2647..3122) /note="matches EST AI888607 from clone IMAGE:2447275" misc_feature complement(2648..3115) /note="matches EST AI271465 from clone IMAGE:1856974" misc_feature complement(2648..3122) /note="matches EST AI362838 from clone IMAGE:2018361" misc_feature complement(2649..3112) /note="matches EST AI493884 from clone IMAGE:2041813" misc_feature complement(2649..3122) /note="matches EST AI149117 from clone IMAGE:1721047" misc_feature complement(2649..3113) /note="matches EST AI028264 from clone IMAGE:1645539" misc_feature complement(2651..3121) /note="matches EST AA701958 from clone 435938" misc_feature complement(2662..3122) /note="matches EST AA860262 from clone IMAGE:1394518" misc_feature complement(2709..3121) /note="matches EST AI263052 from clone IMAGE:2028334" misc_feature complement(2709..3122) /note="matches EST AI391735 from clone IMAGE:2019658" misc_feature complement(2713..3122) /note="matches EST AI206277 from clone IMAGE:1942010" misc_feature complement(2722..3155) /note="matches EST AA507923 from clone IMAGE:964176" misc_feature complement(2735..3122) /note="matches EST AA580882 from clone IMAGE:797320" misc_feature complement(2738..3116) /note="matches EST H41403 from clone 192946" misc_feature complement(2738..3158) /note="matches EST AI203396 from clone IMAGE:1942390" misc_feature 2793..3086 /note="matches EST AI654956 from clone IMAGE:2310581" misc_feature 2801..3072 /note="matches EST AI700602 from clone IMAGE:2343375" misc_feature join(2804..2826,3076..3113) /note="matches EST D18877 from clone mc0232" misc_feature 2807..2929 /note="matches EST AA411312 from clone 754838" BASE COUNT 690 a 741 c 885 g 842 t ORIGIN 1 gaactccctt taaggagcag ccccagccct gctaacagca ctgctggtac cattgacagc 61 gacggctggg acgcgggttt ctcagacatc gcgtcctcag tgcccttgcc agtctctgac 121 cgctgcttta gccacctgca gcctactctc ttgcagcgag ccaagcccag taacttcctg 181 ctggacagaa agaaaacgga caagctgaag aagaagaaga agaggaagcg cagggacagt 241 gatgcgcctg ggaaagaggg gtacaggggg ggcttgctga agctggaagc cgctgacccc 301 tacgtggaga cccccacgag tcccaccttg caggatatcc cccaggctcc cagcgacccc 361 tgctcgggct gggactccga tactccctcg agtggatctt gtgccactgt gtcacctgat 421 caggtcaaag aaataaaaac tgaaggcaaa cggactatcg tccggcaggg aaagcaggtg 481 gtgttccgag atgaggacag cactggcaat gatgaggaca tcatggtgga ctcagatgac 541 gattcctggg acctcgtgac ctgcttctgc atgaagccat ttgccggccg ccccatgatc 601 gagtgtaatg agtgccacac ctggattcac ctgtcctgtg cgaaaatccg gaaatccaat 661 gttccagaag tgtttgtctg ccaaaagtgc cgggactcca agtttgacat ccgccgttcc 721 aaccgctcgc ggacgggctc ccggaagctg ttcctggact gactgctggc tggcgaggag 781 gctgcgagcg tggaatcgga agcgaccgcg ggcttttttg cccttctctt agttgagcac 841 agaaccctca gctctggtgc gggcagatcc ctgccattta ggtgcctaag caaaaggaca 901 ggctgtccaa ggtagaaact gtacatagcc ggtgaccgaa tgcgaccttt gccagccaga 961 gctgctgcca gagctgcgtt ccctgcagtg gaggtggact ggacacccac gtgcagcggg 1021 tttggctcat ttgaaaatga gggtccgtgg tagctgtgcg ttttgctatc attgctaaga 1081 gattcccgct gattgggctc agtgccagct gttattctgc ttccactgtg ttggggagag 1141 gtgttcggtt tccccagcct gttaatgaac agccatacgt gtaagctttt tcttgagtgt 1201 taagtctttt accaaaagtg tctgtacagc agccatccaa gttgccccta cttagtggct 1261 tgccctctgc ctgcctcagc tgctgcctga ccggctgggg gaggcactgg cgggaggcct 1321 cgggctcccc tggaagggcg ctgggctggc gggtcagctg gtggttctta ggtttccttc 1381 tgtttgttaa aagggacaat gtggccactt ctctgtggaa agggagttgg ttggggggtt 1441 gagatggccc gtgttcataa ctcagtttcc tgttttgcac gatgtaaaaa ccctgtcttt 1501 ttgcacgata cagccaaaag tattggctga tttcttgctg agtgccctct tagttggtgt 1561 gtgaggtctt ggtgggctca ggccagctgt ttgcgagtgt gggaactcat aggttctgtc 1621 tttgtctctt cctttcacct cattctggta gcagcataaa ggttaggcaa tcactgggac 1681 ccgcatggtg ttcctccaaa gaatagggta aaggagagct gggagggagc cctctccgtt 1741 gggtgactct tgtgtgccct ttagacaggc tggcctgccg gttccacagg gtacagttag 1801 gacttgagtc tttctttttc tgttttgagt tggtgagtga gtgatagggt aacatgggcc 1861 ttcaggatga ccccttggaa ctgtgccgag ttccttaaat ctcagctggg atcctggacc 1921 tgggaggccc ctgtgagggc cagctctgga aaaacctggg agttgatgcc ggaggctgtg 1981 gaagaactct gctcgagggc agggtgccct ggaacactgg tagttctggg gctgggaggg 2041 agaggggctc cggctttctc tgaaatgaac actgctcttc agcagttcaa gtacttgttc 2101 tcaaaacatt ttctaattga ttggtaggtt ttcataagca ttgtttcttt aaggcatgga 2161 aagggaagaa tgctcaagca agtcatgttt gttttcagtg ggatgggccc gcgttctcac 2221 tgctgggggc ttccccttca tgtggcacct ttgtgccagg ccaccaggca gactcttccc 2281 accttctccc actgaagcac caaggggctt gaaccgtaat ttggctaatc agaggcattt 2341 tttttgtcct agtatctttc acacttgtcc aaccgtctta tttttttaaa agttctgttg 2401 cttgtattaa cacgaaacta gagagaaata gtttctgaag ccagtttatt gtgaagatcc 2461 ccaaggggga ggttcggtag agaaaaatag taagctggtt tagaaactga cgagggcaaa 2521 cagccaggac gcattggaga ggaatttgcc aaagatctac cctgagataa cgcctgtcca 2581 gtgtcttcac cacgtgaata accagcgctc caaagtgttt ttctgctttg aaaaaaaaaa 2641 attccacaag cttttaaagg tgcatttaag aatccatgtg actttagaat ggaactgccg 2701 gccctggcaa ctgtcacgtg tgctagaagg ttcgatgcct ctggaatgca tgtgatactc 2761 atctccattt tgtttccttg attgcatttt tgttctttta gcagatctgt ccctgtgggt 2821 ggtgtctaag aagtcggaca ccttggtttt tgtgttagat tgagctgggc agctgcaatc 2881 agcttcttta tatgcaaatt aggcacgacc catctgtggt tcctggttgg tggctaatga 2941 agtgagggga gggagggatg tcaccccaaa agtaggccct cccattggct ttggccaggc 3001 cagacacttc acatcgttta catggttctg tgtaatttta aagtttatgt gtataaagcg 3061 aagctgtttc tgtgaaactg tatattttgt aaataaatat attgctactt tgaggttcat 3121 gattcaaggt tcaggcgatt gcgttctgtg ctgaagga //