LOCUS       AL121733                3158 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  Novel human gene mapping to chomosome 1.
ACCESSION   AL121733
VERSION     AL121733.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3158)
  AUTHORS   Rhodes S., Huckle E.
  JOURNAL   Submitted (04-OCT-1999) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 126A5 (AL031447).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr1/
            Partial, experimentally determined gene.
            Sanger Centre name : dJ126A5.C1.3
FEATURES             Location/Qualifiers
     source          1..3158
                     /db_xref="H-InvDB:HIT000250274"
                     /organism="Homo sapiens"
                     /chromosome="1"
                     /map="1p36.21-36.33"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..535
                     /number=1
     misc_feature    complement(1..426)
                     /note="matches EST AI589556 from clone IMAGE:2162252"
     CDS             <1..762
                     /product="hypothetical protein"
                     /db_xref="GOA:Q86YI8"
                     /db_xref="H-InvDB:HIT000250274.13"
                     /db_xref="HGNC:HGNC:22983"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR041947"
                     /db_xref="PDB:3O70"
                     /db_xref="PDB:3O7A"
                     /db_xref="UniProtKB/Swiss-Prot:Q86YI8"
                     /protein_id="CAB57324.1"
                     /translation="ELPLRSSPSPANSTAGTIDSDGWDAGFSDIASSVPLPVSDRCFS
                     HLQPTLLQRAKPSNFLLDRKKTDKLKKKKKRKRRDSDAPGKEGYRGGLLKLEAADPYV
                     ETPTSPTLQDIPQAPSDPCSGWDSDTPSSGSCATVSPDQVKEIKTEGKRTIVRQGKQV
                     VFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHTWIHLSCAKIRK
                     SNVPEVFVCQKCRDSKFDIRRSNRSRTGSRKLFLD"
     exon            536..3158
                     /number=2
     misc_feature    complement(746..1184)
                     /note="matches EST AI699367 from clone IMAGE:2301426"
     misc_feature    complement(747..1184)
                     /note="matches EST AI493109 from clone IMAGE:2030270"
     misc_feature    850..1251
                     /note="matches EST AL039383 from clone DKFZp434J0110"
     misc_feature    complement(899..1184)
                     /note="matches EST AI203840 from clone IMAGE:1755898"
     misc_feature    complement(922..1184)
                     /note="matches EST AA810639 from clone IMAGE:1335560"
     misc_feature    join(1106..1264,1454..1476)
                     /note="matches EST T78497 from clone 113362"
     misc_feature    join(1210..1318,1511..1541)
                     /note="matches EST AA143098 from clone 592148"
     misc_feature    2037..2361
                     /note="matches EST AA301263"
     misc_feature    join(2060..2238,2225..2549)
                     /note="matches EST AA234655 from clone 669274"
     misc_feature    join(2071..2114,2257..2356)
                     /note="matches EST AA243230 from clone 664521"
     misc_feature    join(2134..2237,2437..2474)
                     /note="matches EST R63138 from clone 137991"
     misc_feature    join(2136..2256,2257..2568)
                     /note="matches EST AA393513 from clone 728112"
     misc_feature    complement(join(2300..2594,2594..2633))
                     /note="matches EST T78434 from clone 113362"
     misc_feature    2359..2676
                     /note="matches EST AA424611 from clone 767131"
     misc_feature    join(2359..2694,2691..2714)
                     /note="matches EST H56726 from clone 203893"
     misc_feature    join(2395..2754,2754..2780)
                     /note="matches EST R98531 from clone 201157"
     misc_feature    2396..2694
                     /note="matches EST T97087 from clone 121213"
     misc_feature    2396..2995
                     /note="matches EST AA203440 from clone 446534"
     misc_feature    2396..2645
                     /note="matches EST R08738 from clone 127829"
     misc_feature    2540..2584
                     /note="matches EST H26134 from clone 161540"
     misc_feature    complement(2619..3113)
                     /note="matches EST AL039384 from clone DKFZp434J0110"
     misc_feature    complement(2623..3107)
                     /note="matches EST AI633588 from clone IMAGE:2123869"
     misc_feature    complement(join(2628..2991,2991..3113))
                     /note="matches EST AA749089 from clone IMAGE:1271413"
     misc_feature    complement(2628..3113)
                     /note="matches EST AA398641 from clone 728112"
     misc_feature    2628..2812
                     /note="matches EST H21791 from clone 160247"
     misc_feature    2628..2995
                     /note="matches EST AA418661 from clone 767377"
     misc_feature    complement(2628..3102)
                     /note="matches EST AI652643 from clone IMAGE:2307153"
     misc_feature    complement(2628..3112)
                     /note="matches EST AI652376 from clone IMAGE:2310103"
     misc_feature    complement(2634..3122)
                     /note="matches EST AA534923 from clone IMAGE:926075"
     misc_feature    complement(2647..3122)
                     /note="matches EST AI888607 from clone IMAGE:2447275"
     misc_feature    complement(2648..3115)
                     /note="matches EST AI271465 from clone IMAGE:1856974"
     misc_feature    complement(2648..3122)
                     /note="matches EST AI362838 from clone IMAGE:2018361"
     misc_feature    complement(2649..3112)
                     /note="matches EST AI493884 from clone IMAGE:2041813"
     misc_feature    complement(2649..3122)
                     /note="matches EST AI149117 from clone IMAGE:1721047"
     misc_feature    complement(2649..3113)
                     /note="matches EST AI028264 from clone IMAGE:1645539"
     misc_feature    complement(2651..3121)
                     /note="matches EST AA701958 from clone 435938"
     misc_feature    complement(2662..3122)
                     /note="matches EST AA860262 from clone IMAGE:1394518"
     misc_feature    complement(2709..3121)
                     /note="matches EST AI263052 from clone IMAGE:2028334"
     misc_feature    complement(2709..3122)
                     /note="matches EST AI391735 from clone IMAGE:2019658"
     misc_feature    complement(2713..3122)
                     /note="matches EST AI206277 from clone IMAGE:1942010"
     misc_feature    complement(2722..3155)
                     /note="matches EST AA507923 from clone IMAGE:964176"
     misc_feature    complement(2735..3122)
                     /note="matches EST AA580882 from clone IMAGE:797320"
     misc_feature    complement(2738..3116)
                     /note="matches EST H41403 from clone 192946"
     misc_feature    complement(2738..3158)
                     /note="matches EST AI203396 from clone IMAGE:1942390"
     misc_feature    2793..3086
                     /note="matches EST AI654956 from clone IMAGE:2310581"
     misc_feature    2801..3072
                     /note="matches EST AI700602 from clone IMAGE:2343375"
     misc_feature    join(2804..2826,3076..3113)
                     /note="matches EST D18877 from clone mc0232"
     misc_feature    2807..2929
                     /note="matches EST AA411312 from clone 754838"
BASE COUNT          690 a          741 c          885 g          842 t
ORIGIN      
        1 gaactccctt taaggagcag ccccagccct gctaacagca ctgctggtac cattgacagc
       61 gacggctggg acgcgggttt ctcagacatc gcgtcctcag tgcccttgcc agtctctgac
      121 cgctgcttta gccacctgca gcctactctc ttgcagcgag ccaagcccag taacttcctg
      181 ctggacagaa agaaaacgga caagctgaag aagaagaaga agaggaagcg cagggacagt
      241 gatgcgcctg ggaaagaggg gtacaggggg ggcttgctga agctggaagc cgctgacccc
      301 tacgtggaga cccccacgag tcccaccttg caggatatcc cccaggctcc cagcgacccc
      361 tgctcgggct gggactccga tactccctcg agtggatctt gtgccactgt gtcacctgat
      421 caggtcaaag aaataaaaac tgaaggcaaa cggactatcg tccggcaggg aaagcaggtg
      481 gtgttccgag atgaggacag cactggcaat gatgaggaca tcatggtgga ctcagatgac
      541 gattcctggg acctcgtgac ctgcttctgc atgaagccat ttgccggccg ccccatgatc
      601 gagtgtaatg agtgccacac ctggattcac ctgtcctgtg cgaaaatccg gaaatccaat
      661 gttccagaag tgtttgtctg ccaaaagtgc cgggactcca agtttgacat ccgccgttcc
      721 aaccgctcgc ggacgggctc ccggaagctg ttcctggact gactgctggc tggcgaggag
      781 gctgcgagcg tggaatcgga agcgaccgcg ggcttttttg cccttctctt agttgagcac
      841 agaaccctca gctctggtgc gggcagatcc ctgccattta ggtgcctaag caaaaggaca
      901 ggctgtccaa ggtagaaact gtacatagcc ggtgaccgaa tgcgaccttt gccagccaga
      961 gctgctgcca gagctgcgtt ccctgcagtg gaggtggact ggacacccac gtgcagcggg
     1021 tttggctcat ttgaaaatga gggtccgtgg tagctgtgcg ttttgctatc attgctaaga
     1081 gattcccgct gattgggctc agtgccagct gttattctgc ttccactgtg ttggggagag
     1141 gtgttcggtt tccccagcct gttaatgaac agccatacgt gtaagctttt tcttgagtgt
     1201 taagtctttt accaaaagtg tctgtacagc agccatccaa gttgccccta cttagtggct
     1261 tgccctctgc ctgcctcagc tgctgcctga ccggctgggg gaggcactgg cgggaggcct
     1321 cgggctcccc tggaagggcg ctgggctggc gggtcagctg gtggttctta ggtttccttc
     1381 tgtttgttaa aagggacaat gtggccactt ctctgtggaa agggagttgg ttggggggtt
     1441 gagatggccc gtgttcataa ctcagtttcc tgttttgcac gatgtaaaaa ccctgtcttt
     1501 ttgcacgata cagccaaaag tattggctga tttcttgctg agtgccctct tagttggtgt
     1561 gtgaggtctt ggtgggctca ggccagctgt ttgcgagtgt gggaactcat aggttctgtc
     1621 tttgtctctt cctttcacct cattctggta gcagcataaa ggttaggcaa tcactgggac
     1681 ccgcatggtg ttcctccaaa gaatagggta aaggagagct gggagggagc cctctccgtt
     1741 gggtgactct tgtgtgccct ttagacaggc tggcctgccg gttccacagg gtacagttag
     1801 gacttgagtc tttctttttc tgttttgagt tggtgagtga gtgatagggt aacatgggcc
     1861 ttcaggatga ccccttggaa ctgtgccgag ttccttaaat ctcagctggg atcctggacc
     1921 tgggaggccc ctgtgagggc cagctctgga aaaacctggg agttgatgcc ggaggctgtg
     1981 gaagaactct gctcgagggc agggtgccct ggaacactgg tagttctggg gctgggaggg
     2041 agaggggctc cggctttctc tgaaatgaac actgctcttc agcagttcaa gtacttgttc
     2101 tcaaaacatt ttctaattga ttggtaggtt ttcataagca ttgtttcttt aaggcatgga
     2161 aagggaagaa tgctcaagca agtcatgttt gttttcagtg ggatgggccc gcgttctcac
     2221 tgctgggggc ttccccttca tgtggcacct ttgtgccagg ccaccaggca gactcttccc
     2281 accttctccc actgaagcac caaggggctt gaaccgtaat ttggctaatc agaggcattt
     2341 tttttgtcct agtatctttc acacttgtcc aaccgtctta tttttttaaa agttctgttg
     2401 cttgtattaa cacgaaacta gagagaaata gtttctgaag ccagtttatt gtgaagatcc
     2461 ccaaggggga ggttcggtag agaaaaatag taagctggtt tagaaactga cgagggcaaa
     2521 cagccaggac gcattggaga ggaatttgcc aaagatctac cctgagataa cgcctgtcca
     2581 gtgtcttcac cacgtgaata accagcgctc caaagtgttt ttctgctttg aaaaaaaaaa
     2641 attccacaag cttttaaagg tgcatttaag aatccatgtg actttagaat ggaactgccg
     2701 gccctggcaa ctgtcacgtg tgctagaagg ttcgatgcct ctggaatgca tgtgatactc
     2761 atctccattt tgtttccttg attgcatttt tgttctttta gcagatctgt ccctgtgggt
     2821 ggtgtctaag aagtcggaca ccttggtttt tgtgttagat tgagctgggc agctgcaatc
     2881 agcttcttta tatgcaaatt aggcacgacc catctgtggt tcctggttgg tggctaatga
     2941 agtgagggga gggagggatg tcaccccaaa agtaggccct cccattggct ttggccaggc
     3001 cagacacttc acatcgttta catggttctg tgtaatttta aagtttatgt gtataaagcg
     3061 aagctgtttc tgtgaaactg tatattttgt aaataaatat attgctactt tgaggttcat
     3121 gattcaaggt tcaggcgatt gcgttctgtg ctgaagga
//