LOCUS AL110183 568 bp mRNA linear HTC 15-OCT-2008 DEFINITION Homo sapiens mRNA; cDNA DKFZp566A221 (from clone DKFZp566A221). ACCESSION AL110183 VERSION AL110183.1 KEYWORDS HTC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 568) AUTHORS Blum H., Bauersachs S., Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S. CONSRTM The German cDNA Consortium JOURNAL Submitted (20-JAN-2005) to the INSDC. MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de; sequenced by LMU (Ludwig Maximilians University, Munich/Germany) within the cDNA sequencing consortium of the German Genome Project. This clone (DKFZp566A221) is available at the RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany. Please contact RZPD for ordering: http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp566A221 Further information about the clone and the sequencing project is available at http://mips.gsf.de/projects/cdna/ FEATURES Location/Qualifiers source 1..568 /db_xref="H-InvDB:HIT000024449" /organism="Homo sapiens" /mol_type="mRNA" /dev_stage="fetal" /clone_lib="566 (synonym: hfkd2). Vector pAMP1; host Xl-2blue; sites NotI + SalI" /clone="DKFZp566A221" /tissue_type="kidney" /note="ATP synthase, H+ transporting, mitochondrial precursor" /db_xref="taxon:9606" CDS 82..408 /codon_start=1 /gene="DKFZp566A221" /product="hypothetical protein" /db_xref="GOA:P18859" /db_xref="H-InvDB:HIT000024449.16" /db_xref="HGNC:HGNC:847" /db_xref="InterPro:IPR008387" /db_xref="InterPro:IPR036204" /db_xref="UniProtKB/Swiss-Prot:P18859" /protein_id="CAB53667.1" /translation="MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFV DKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEV IEKPQA" BASE COUNT 184 a 98 c 136 g 150 t ORIGIN 1 ggggggagcc agggccggaa gtagagcgga ggtggtggcg gcggaggctt tggcagctcg 61 ggactgagtg caagaatcag catgattctt cagaggctct tcaggttctc ctctgtcatt 121 cggtcagccg tctcagtcca tttgcggagg aacattggtg ttacagcagt ggcatttaat 181 aaggaacttg atcctataca gaaactcttt gtggacaaga ttagagaata caaatctaag 241 cgacagacat ctggaggacc tgttgatgct agttcagagt atcagcaaga gctggagagg 301 gagcttttta agctcaagca aatgtttggt aatgcagaca tgaatacatt tcccaccttc 361 aaatttgaag atcccaaatt tgaagtcatc gaaaaacccc aggcctgaag aaataaagta 421 aaattaatct ggtaatttgt cacggattag ttgtacaact agttagaagt ttcagaataa 481 acatgcattt cataactgtc aaatgttctt ttaattctga gtccaaataa attatttggt 541 gatgttgaaa aaaaaaaaaa aaaaaaac //