LOCUS AL109978 1357 bp mRNA linear HUM 15-OCT-2008 DEFINITION Novel human gene mapping to chomosome 1. ACCESSION AL109978 VERSION AL109978.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1357) AUTHORS Rhodes S., Huckle E. JOURNAL Submitted (19-AUG-1999) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 126A5 (AL031447). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr1/ Partial, experimentally determined gene, with isoform dJ126A5.1.1 Sanger Centre name : dJ126A5.C1.1.2 FEATURES Location/Qualifiers source 1..1357 /db_xref="H-InvDB:HIT000250236" /organism="Homo sapiens" /chromosome="1" /map="1p36.21-36.33" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..130 /number=1 misc_feature join(1..21,20..237) /note="matches EST AA299970" misc_feature join(1..22,36..175) /note="matches EST R57617 from clone F3875" CDS 43..999 /product="hypothetical protein" /db_xref="H-InvDB:HIT000250236.13" /db_xref="InterPro:IPR001623" /db_xref="InterPro:IPR018253" /db_xref="InterPro:IPR036869" /db_xref="UniProtKB/TrEMBL:Q9UMU8" /protein_id="CAB53376.1" /translation="MLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYDIYG KRGLEMEGWEVVERRRTPAEIREEFERLQREREERRLQQRTNPKGTISVGVDATDLFD RYDEEYEDVSGSSFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFA LRRVTSAKGWGELEFGAGDLQGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTT VLARNLDKNTVGYLQWHCSSPLLQVQRPHRNTRACAPEPSFRPFLHVPTWDAECSGAR TPSTAWTSAAVKLREACLSGPGSGSHQLLLLTPRSKRRTGGG" exon 131..204 /number=2 exon 205..306 /number=3 exon 307..435 /number=4 misc_feature 393..438 /note="matches EST AA711618 from clone 1193029" exon 436..558 /number=5 misc_feature 544..790 /note="matches EST AA359216" exon 559..632 /number=6 exon 633..740 /number=7 misc_feature 633..705 /note="matches EST R99476 from clone 201234" exon 741..1357 /number=8 misc_feature join(741..921,923..995) /note="matches EST AA046839 from clone 376912" misc_feature complement(741..1337) /note="matches EST AL040438 from clone DKFZp434C0414" misc_feature complement(join(811..859,861..977,1006..1023,1031..1204)) /note="matches EST AA047010 from clone 376912" misc_feature join(820..856,859..1047) /note="matches EST AA029771 from clone 469820" misc_feature complement(848..1205) /note="matches EST AI768112 from clone IMAGE:2371498" misc_feature complement(851..1356) /note="matches EST AI017434 from clone IMAGE:1635698" misc_feature 870..1220 /note="matches EST AA039966 from clone 485768" misc_feature complement(893..982) /note="matches EST AA029772 from clone 469820" misc_feature complement(join(902..918,915..937)) /note="matches EST AA069571 from clone 382733" misc_feature complement(join(906..1086,1087..1356)) /note="matches EST AI568134 from clone IMAGE:2188826" misc_feature complement(907..1355) /note="matches EST AI123786 from clone IMAGE:1567208" misc_feature complement(939..1174) /note="matches EST AI078071 from clone IMAGE:1675200" misc_feature complement(join(941..1056,1054..1315,1321..1355)) /note="matches EST AI382155 from clone IMAGE:2087437" misc_feature complement(941..1034) /note="matches EST AA649997 from clone IMAGE:1187594" misc_feature complement(941..1357) /note="matches EST AI057398 from clone IMAGE:1652673" misc_feature complement(join(943..997,999..1357)) /note="matches EST AI563942 from clone IMAGE:2169251" misc_feature complement(977..1354) /note="matches EST T17221" misc_feature complement(984..1357) /note="matches EST AI632460 from clone IMAGE:2305155" misc_feature complement(990..1356) /note="matches EST AI805104 from clone IMAGE:2253874" misc_feature complement(997..1356) /note="matches EST AI582553 from clone IMAGE:2227426" misc_feature complement(1001..1357) /note="matches EST AI146735 from clone IMAGE:1707564" misc_feature complement(1004..1357) /note="matches EST AI521797 from clone IMAGE:2138534" misc_feature complement(1013..1357) /note="matches EST AI280130 from clone IMAGE:1854328" misc_feature complement(1031..1204) /note="matches EST R60577 from clone 37751" misc_feature complement(1041..1357) /note="matches EST AA039881 from clone 485768" misc_feature complement(1104..1357) /note="matches EST AI765202 from clone IMAGE:2398882" misc_feature complement(1117..1357) /note="matches EST AI784405 from clone IMAGE:2264777" misc_feature complement(join(1239..1270,1271..1354)) /note="matches EST W87458 from clone 417105" misc_feature complement(1265..1357) /note="matches EST H10997 from clone 47153" BASE COUNT 316 a 382 c 371 g 288 t ORIGIN 1 gcctcttctg aagagctgaa agctgcctac cggaggctct gtatgctcta ccatccagac 61 aagcacagag acccagagct caagtcacag gcggaacgac tgtttaacct tgttcaccag 121 gcttatgaag tgcttagtga cccccaaacc agggccatct atgatatata tgggaagaga 181 ggactggaaa tggaaggatg ggaggttgtg gaaaggagga gaacccctgc tgaaattcga 241 gaggagtttg agcggctgca gagagagaga gaagagagga gattgcagca gcgaaccaat 301 cccaagggaa cgatcagcgt tggagtagat gccaccgacc tttttgatcg ctatgatgag 361 gagtatgaag atgtgtccgg cagtagcttt ccgcagattg aaattaataa aatgcacata 421 tcccagtcca ttgaggcacc cttgacagcg acagacacag ccatcctctc tggaagcctc 481 tcaacccaga atggaaatgg aggaggttcc attaactttg cgctcagacg agtaacttcg 541 gcaaagggat ggggagagtt ggaatttgga gctggagacc tacaggggcc tttgttcggt 601 ctcaagctgt tccgtaatct cacaccaaga tgctttgtga caacaaactg tgctctgcag 661 ttttcatccc gtggaatccg acccggcctg accactgtcc tagctcggaa cctagacaag 721 aacaccgtgg gctacctgca gtggcactgc agctccccgc tcctgcaggt ccagcgtcct 781 cacaggaaca ccagggcctg tgctccggag ccttccttca gacccttcct ccacgtgccc 841 acttgggatg cagaatgcag cggagctagg accccctcca cggcctggac ctcggctgca 901 gtaaagttac gtgaggcctg tctctcgggg cctggaagtg gcagccatca gttgctcttg 961 ctgacccctc ggagcaagcg ccgcacaggt ggtggctgag acagctggcg cggggggccc 1021 caagctgcgc cggcctccag cccacccaca gctgttgctg aagtcaggcc tccctcccca 1081 gcactggtat ctgagtaacg gctaagaacc tccttcctct ggttttgaaa agcagttcgg 1141 gttgtccaat tctgtaacat tcatctccat tttttaaaaa ggtttctctg acggccccac 1201 ggcccgagcc gcggtgagcg tcgtgttgca tgagcctggg ccccgggctt cccgtgcgcc 1261 tctgccgcag gtgcttctgg gcacccatcc tctgcgtttc atttgcagtc gactgtacag 1321 aaggcactca ccacaataaa cctttcctga aagcaga //