LOCUS       AL109978                1357 bp    mRNA    linear   HUM 15-OCT-2008
DEFINITION  Novel human gene mapping to chomosome 1.
ACCESSION   AL109978
VERSION     AL109978.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1357)
  AUTHORS   Rhodes S., Huckle E.
  JOURNAL   Submitted (19-AUG-1999) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 126A5 (AL031447).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr1/
            Partial, experimentally determined gene, with isoform dJ126A5.1.1
            Sanger Centre name : dJ126A5.C1.1.2
FEATURES             Location/Qualifiers
     source          1..1357
                     /db_xref="H-InvDB:HIT000250236"
                     /organism="Homo sapiens"
                     /chromosome="1"
                     /map="1p36.21-36.33"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..130
                     /number=1
     misc_feature    join(1..21,20..237)
                     /note="matches EST AA299970"
     misc_feature    join(1..22,36..175)
                     /note="matches EST R57617 from clone F3875"
     CDS             43..999
                     /product="hypothetical protein"
                     /db_xref="H-InvDB:HIT000250236.13"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR036869"
                     /db_xref="UniProtKB/TrEMBL:Q9UMU8"
                     /protein_id="CAB53376.1"
                     /translation="MLYHPDKHRDPELKSQAERLFNLVHQAYEVLSDPQTRAIYDIYG
                     KRGLEMEGWEVVERRRTPAEIREEFERLQREREERRLQQRTNPKGTISVGVDATDLFD
                     RYDEEYEDVSGSSFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFA
                     LRRVTSAKGWGELEFGAGDLQGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTT
                     VLARNLDKNTVGYLQWHCSSPLLQVQRPHRNTRACAPEPSFRPFLHVPTWDAECSGAR
                     TPSTAWTSAAVKLREACLSGPGSGSHQLLLLTPRSKRRTGGG"
     exon            131..204
                     /number=2
     exon            205..306
                     /number=3
     exon            307..435
                     /number=4
     misc_feature    393..438
                     /note="matches EST AA711618 from clone 1193029"
     exon            436..558
                     /number=5
     misc_feature    544..790
                     /note="matches EST AA359216"
     exon            559..632
                     /number=6
     exon            633..740
                     /number=7
     misc_feature    633..705
                     /note="matches EST R99476 from clone 201234"
     exon            741..1357
                     /number=8
     misc_feature    join(741..921,923..995)
                     /note="matches EST AA046839 from clone 376912"
     misc_feature    complement(741..1337)
                     /note="matches EST AL040438 from clone DKFZp434C0414"
     misc_feature    complement(join(811..859,861..977,1006..1023,1031..1204))
                     /note="matches EST AA047010 from clone 376912"
     misc_feature    join(820..856,859..1047)
                     /note="matches EST AA029771 from clone 469820"
     misc_feature    complement(848..1205)
                     /note="matches EST AI768112 from clone IMAGE:2371498"
     misc_feature    complement(851..1356)
                     /note="matches EST AI017434 from clone IMAGE:1635698"
     misc_feature    870..1220
                     /note="matches EST AA039966 from clone 485768"
     misc_feature    complement(893..982)
                     /note="matches EST AA029772 from clone 469820"
     misc_feature    complement(join(902..918,915..937))
                     /note="matches EST AA069571 from clone 382733"
     misc_feature    complement(join(906..1086,1087..1356))
                     /note="matches EST AI568134 from clone IMAGE:2188826"
     misc_feature    complement(907..1355)
                     /note="matches EST AI123786 from clone IMAGE:1567208"
     misc_feature    complement(939..1174)
                     /note="matches EST AI078071 from clone IMAGE:1675200"
     misc_feature    complement(join(941..1056,1054..1315,1321..1355))
                     /note="matches EST AI382155 from clone IMAGE:2087437"
     misc_feature    complement(941..1034)
                     /note="matches EST AA649997 from clone IMAGE:1187594"
     misc_feature    complement(941..1357)
                     /note="matches EST AI057398 from clone IMAGE:1652673"
     misc_feature    complement(join(943..997,999..1357))
                     /note="matches EST AI563942 from clone IMAGE:2169251"
     misc_feature    complement(977..1354)
                     /note="matches EST T17221"
     misc_feature    complement(984..1357)
                     /note="matches EST AI632460 from clone IMAGE:2305155"
     misc_feature    complement(990..1356)
                     /note="matches EST AI805104 from clone IMAGE:2253874"
     misc_feature    complement(997..1356)
                     /note="matches EST AI582553 from clone IMAGE:2227426"
     misc_feature    complement(1001..1357)
                     /note="matches EST AI146735 from clone IMAGE:1707564"
     misc_feature    complement(1004..1357)
                     /note="matches EST AI521797 from clone IMAGE:2138534"
     misc_feature    complement(1013..1357)
                     /note="matches EST AI280130 from clone IMAGE:1854328"
     misc_feature    complement(1031..1204)
                     /note="matches EST R60577 from clone 37751"
     misc_feature    complement(1041..1357)
                     /note="matches EST AA039881 from clone 485768"
     misc_feature    complement(1104..1357)
                     /note="matches EST AI765202 from clone IMAGE:2398882"
     misc_feature    complement(1117..1357)
                     /note="matches EST AI784405 from clone IMAGE:2264777"
     misc_feature    complement(join(1239..1270,1271..1354))
                     /note="matches EST W87458 from clone 417105"
     misc_feature    complement(1265..1357)
                     /note="matches EST H10997 from clone 47153"
BASE COUNT          316 a          382 c          371 g          288 t
ORIGIN      
        1 gcctcttctg aagagctgaa agctgcctac cggaggctct gtatgctcta ccatccagac
       61 aagcacagag acccagagct caagtcacag gcggaacgac tgtttaacct tgttcaccag
      121 gcttatgaag tgcttagtga cccccaaacc agggccatct atgatatata tgggaagaga
      181 ggactggaaa tggaaggatg ggaggttgtg gaaaggagga gaacccctgc tgaaattcga
      241 gaggagtttg agcggctgca gagagagaga gaagagagga gattgcagca gcgaaccaat
      301 cccaagggaa cgatcagcgt tggagtagat gccaccgacc tttttgatcg ctatgatgag
      361 gagtatgaag atgtgtccgg cagtagcttt ccgcagattg aaattaataa aatgcacata
      421 tcccagtcca ttgaggcacc cttgacagcg acagacacag ccatcctctc tggaagcctc
      481 tcaacccaga atggaaatgg aggaggttcc attaactttg cgctcagacg agtaacttcg
      541 gcaaagggat ggggagagtt ggaatttgga gctggagacc tacaggggcc tttgttcggt
      601 ctcaagctgt tccgtaatct cacaccaaga tgctttgtga caacaaactg tgctctgcag
      661 ttttcatccc gtggaatccg acccggcctg accactgtcc tagctcggaa cctagacaag
      721 aacaccgtgg gctacctgca gtggcactgc agctccccgc tcctgcaggt ccagcgtcct
      781 cacaggaaca ccagggcctg tgctccggag ccttccttca gacccttcct ccacgtgccc
      841 acttgggatg cagaatgcag cggagctagg accccctcca cggcctggac ctcggctgca
      901 gtaaagttac gtgaggcctg tctctcgggg cctggaagtg gcagccatca gttgctcttg
      961 ctgacccctc ggagcaagcg ccgcacaggt ggtggctgag acagctggcg cggggggccc
     1021 caagctgcgc cggcctccag cccacccaca gctgttgctg aagtcaggcc tccctcccca
     1081 gcactggtat ctgagtaacg gctaagaacc tccttcctct ggttttgaaa agcagttcgg
     1141 gttgtccaat tctgtaacat tcatctccat tttttaaaaa ggtttctctg acggccccac
     1201 ggcccgagcc gcggtgagcg tcgtgttgca tgagcctggg ccccgggctt cccgtgcgcc
     1261 tctgccgcag gtgcttctgg gcacccatcc tctgcgtttc atttgcagtc gactgtacag
     1321 aaggcactca ccacaataaa cctttcctga aagcaga
//