LOCUS AL096779 1416 bp mRNA linear HUM 14-NOV-2006
DEFINITION Novel human gene mapping to chomosome 22q13.3 similar to yeast ORF
YOR070C, putative GTPase Activator (start missing).
ACCESSION AL096779
VERSION AL096779.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1416)
AUTHORS Smink L.J., Huckle E.J.
JOURNAL Submitted (04-OCT-1999) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the bacterial clone N79E2 (U51561).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
FEATURES Location/Qualifiers
source 1..1416
/db_xref="H-InvDB:HIT000250145"
/organism="Homo sapiens"
/chromosome="22"
/map="q13.3"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..72
/number=1
misc_feature 1..108
/note="matches EST D31239"
misc_feature complement(1..115)
/note="matches EST AI478832 from clone IMAGE:2161779"
misc_feature complement(1..118)
/note="matches EST AI092397 from clone IMAGE:1689029"
misc_feature complement(1..119)
/note="matches EST AA971772 from clone IMAGE:1583715"
misc_feature complement(1..51)
/note="matches EST AA765901 from clone IMAGE:1306071"
CDS 52..918
/product="hypothetical protein"
/db_xref="GOA:Q8WUA7"
/db_xref="H-InvDB:HIT000250145.13"
/db_xref="HGNC:HGNC:1309"
/db_xref="InterPro:IPR000195"
/db_xref="InterPro:IPR035969"
/db_xref="PDB:2QFZ"
/db_xref="UniProtKB/Swiss-Prot:Q8WUA7"
/protein_id="CAB46628.1"
/translation="MTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVH
QDTYRQIHIDIPRMSPEALILQPKVTEIFERILFIWAIRHPASGYVQGINDLVTPFFV
VFICEYIEAEEVDTVDVSGVPAEVLCNIEADTYWCMSKLLDGIQDNYTFAQPGIQMKV
KMLEELVSRIDEQVHRHLDQHEVRYLQFAFRWMNNLLMREVPLRCTIRLWDTYQSEPD
GFSHFHLYVCAAFLVRWRKEILEEKDFQELLLFLQNLPTAHWDDEDISLLLAEAYRLK
FAFADAPNHYKK"
exon 73..201
/number=2
misc_feature join(73..235,233..264)
/note="matches EST H55230 from clone C22_212"
exon 202..264
/number=3
misc_feature 214..379
/note="matches EST H71961 from clone 213303"
misc_feature join(215..304,301..379)
/note="matches EST R97618 from clone 200101"
exon 265..379
/number=4
misc_feature 265..379
/note="matches EST H55231 from clone C22_213"
exon 380..489
/number=5
misc_feature 434..746
/note="matches EST AA316755"
exon 490..565
/number=6
misc_feature 490..565
/note="matches EST H55282 from clone C22_274"
exon 566..693
/number=7
misc_feature join(566..599,601..693)
/note="matches EST H55205 from clone C22_182"
misc_feature join(598..866,865..1000)
/note="matches EST AA233698 from clone 666599"
misc_feature join(598..866,865..1032)
/note="matches EST AA252908 from clone 669290"
misc_feature 607..932
/note="matches EST R07694 from clone 125797"
misc_feature complement(617..926)
/note="matches EST AI751947 from clone NHTBC_cn12g07"
misc_feature 684..774
/note="matches EST AA743835 from clone IMAGE:1308612"
exon 694..789
/number=8
misc_feature 694..789
/note="matches EST H55580 from clone C22_704"
exon 790..1379
/number=9
misc_feature complement(join(826..1007,1003..1110,1108..1380))
/note="matches EST AI659320 from clone IMAGE:2252437"
misc_feature complement(join(942..1007,1003..1385))
/note="matches EST AI005114 from clone IMAGE:1626279"
misc_feature complement(join(983..1007,1003..1218,1223..1386))
/note="matches EST AA443897 from clone 756679"
misc_feature complement(1003..1370)
/note="matches EST AI702932 from clone IMAGE:2296364"
/note="matches EST AI223787 from clone IMAGE:1858252"
misc_feature complement(join(1028..1156,1234..1373))
/note="matches EST AA948330 from clone IMAGE:1589355"
misc_feature complement(join(1030..1156,1227..1371))
/note="matches EST AA253303 from clone 669290"
misc_feature complement(join(1031..1227,1222..1389))
/note="matches EST AA833783 from clone IMAGE:1372449"
misc_feature complement(join(1040..1156,1225..1374))
/note="matches EST AA812307 from clone IMAGE:1175048"
misc_feature complement(1092..1381)
/note="matches EST AI202402 from clone IMAGE:1943521"
misc_feature complement(1094..1380)
/note="matches EST AI522309 from clone IMAGE:2137953"
misc_feature complement(1131..1386)
/note="matches EST AI739090 from clone IMAGE:2390554"
misc_feature complement(1160..1389)
/note="matches EST AI469626 from clone IMAGE:2157080"
misc_feature complement(1171..1377)
/note="matches EST AA278287 from clone IMAGE:703754"
misc_feature complement(1225..1370)
/note="matches EST AA528056 from clone IMAGE:901880"
misc_feature complement(1226..1389)
/note="matches EST R49123 from clone 38496"
misc_feature complement(1229..1386)
/note="matches EST AA782652 from clone 1389590"
misc_feature complement(1265..1381)
/note="matches EST AA806731 from clone IMAGE:1338377"
BASE COUNT 341 a 385 c 386 g 304 t
ORIGIN
1 gaggaattac ggaggttgag ctggtccgga atccctaagc cagtgcgtcc aatgacgtgg
61 aagctcctct caggttacct tcccgccaat gtagaccgga gaccagccac tctccagaga
121 aaacaaaaag aatattttgc atttattgag cactattacg attctaggaa cgacgaagtt
181 caccaggaca catacaggca gatccacata gacatccctc gcatgagccc tgaagcgttg
241 atcctgcagc ccaaggtgac ggagattttt gaaaggatct tgttcatatg ggcgatccgc
301 cacccagcca gtggatacgt tcagggtata aatgatctcg tcactccttt ctttgtggtc
361 ttcatttgtg aatacataga ggcagaggag gtggacacgg tggacgtctc cggcgtgccc
421 gcagaggtgc tgtgcaacat cgaggccgac acctactggt gcatgagcaa gctgctggat
481 ggcattcagg acaactacac ctttgcccaa cctgggattc aaatgaaagt gaaaatgtta
541 gaagaactcg tgagccggat tgatgagcaa gtgcaccggc acctggacca acacgaagtg
601 agatacctgc agtttgcctt ccgctggatg aacaacctgc tgatgaggga ggtgcccctg
661 cgttgtacca tccgcctgtg ggacacctac cagtctgaac cggacggctt ttctcatttc
721 cacttgtacg tgtgcgctgc ttttctcgtg agatggagga aggaaatact agaagaaaaa
781 gattttcaag agctgctgct cttcctccag aacctgccca cagcccactg ggatgatgag
841 gacatcagcc tgttgctggc cgaggcctac cgcctcaagt ttgcttttgc cgacgccccc
901 aatcactaca agaaatgagc ccaggcccac ccgcagctgg cctcactgtc ccgggtggcg
961 cgccccacct gcctggctgg tggtaggccc ctgtgagctg gtccgggctg ctaaaaggcc
1021 ttgtgaggtg gccccaccct ccaggggagc tggtgaagat gggccacaga cctggtctag
1081 ggctgacaaa gacagggaca gcctttgttt tttgagatac caaaaagagc caggggaggg
1141 ccccgggttc ggcggccaga ggcaggtcag gggtcccctc tccctctccc tgcaatgtcc
1201 ttgccaaatg actgcctcct gctgccccta gtccggggca gcctaggagg ccgaccctct
1261 ttggagtcct gctgtttggg tgccagggcc ggaacgaggt agtggccatc tcatacctac
1321 tctgaaatgc aaaacttcta ttctgttgag tgaaagaata aaatgtagcc aaaatctaaa
1381 aaaaaagaat tccaccacac tggcggccgc aaggag
//