LOCUS AL096778 1538 bp mRNA linear HUM 15-OCT-2008 DEFINITION Novel human mRNA from chromosome 20, similar to SW:GOLI_DROME Q06003 GOLIATH PROTEIN. ACCESSION AL096778 VERSION AL096778.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1538) AUTHORS Stavrides G.S., Huckle E.J., Deloukas P. JOURNAL Submitted (02-JUL-1999) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 681N20 (AL031670). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr20/ Sanger Centre name : dJ681N20.C20.1 FEATURES Location/Qualifiers source 1..1538 /db_xref="H-InvDB:HIT000250144" /organism="Homo sapiens" /chromosome="20" /map="p12.1-13" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..245 /number=1 misc_feature 1..461 /note="matches EST AI146409 from clone IMAGE:1685943" misc_feature join(99..180,204..494) /note="matches EST AI094674 from clone IMAGE:1670460" misc_feature 245..396 /note="matches EST AA510027 from clone 890735" exon 246..395 /number=2 CDS 253..699 /product="hypothetical protein" /db_xref="GOA:Q9Y225" /db_xref="H-InvDB:HIT000250144.14" /db_xref="HGNC:HGNC:13779" /db_xref="InterPro:IPR001841" /db_xref="InterPro:IPR011016" /db_xref="InterPro:IPR013083" /db_xref="InterPro:IPR040098" /db_xref="PDB:2EP4" /db_xref="UniProtKB/Swiss-Prot:Q9Y225" /protein_id="CAB46627.1" /translation="MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCC YLIRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHR KCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV" misc_feature 388..681 /note="matches EST AA152152 from clone 566628" exon 396..438 /number=3 exon 439..480 /number=4 exon 481..560 /number=5 exon 561..1538 /number=6 misc_feature join(709..887,885..919,918..935,941..963) /note="matches EST T65892 from clone 80377" misc_feature join(716..903,895..1004) /note="matches EST AA046136 from clone 376622" misc_feature join(716..1184,1184..1282) /note="matches EST AA478922 from clone 754209" misc_feature join(778..1104,1128..1170) /note="matches EST AA134350 from clone 587757" misc_feature 892..1144 /note="matches EST AA346290" misc_feature join(1027..1184,1184..1507) /note="matches EST AA431649 from clone 781576" misc_feature 1152..1386 /note="matches EST AA327926" misc_feature complement(1188..1538) /note="matches EST AI58288 from clone IMAGE:2227857" misc_feature complement(1192..1538) /note="matches EST AA478801 from clone 754209" misc_feature complement(1207..1379) /note="matches EST AI080149 from clone IMAGE:1678539" misc_feature complement(1216..1538) /note="matches EST AA149997 from clone 566628" misc_feature complement(1218..1538) /note="matches EST AI379183 from clone IMAGE:2069577" misc_feature complement(1241..1538) /note="matches EST AA134351 from clone 587757" misc_feature complement(1245..1538) /note="matches EST AI189598 from clone IMAGE:1725454" misc_feature complement(1246..1538) /note="matches EST AI215604 from clone IMAGE:1845023" misc_feature complement(1247..1538) /note="matches EST T65776 from clone 80377" misc_feature complement(1267..1538) /note="matches EST AA431287 from clone 781528" misc_feature complement(1295..1538) /note="matches EST AI040271 from clone IMAGE:1663791" BASE COUNT 353 a 420 c 412 g 353 t ORIGIN 1 ctggggtttg ggggaccgag ccgctccggg ttcgggatgc tgaggagacc gcgggcccgc 61 gccagcctcc cacacacaca cactctcccg gcgcctcggc cggccgggcg cggtgtgcag 121 gggtgaggcg gtgtctccag gctgaggagg gacgcggagg agggtccggc gcggccccgg 181 gactggaggg tgagtccctc acaaagggcg gagcggggct gtcacctgga gatcacggag 241 ggaagttcat ccatgagctc ggatttccca cattacaact tcaggatgcc taatattgga 301 ttccagaatc tgcctctcaa catatatatt gtggtttttg gtactgctat atttgtcttc 361 atccttagtt tactcttctg ttgctacttg attaggctaa gacatcaagc acacaaagaa 421 ttttatgcct acaaacaggt tatattaaaa gagaaagtaa aagaattgaa tttacatgag 481 ctctgtgcag tgtgcctaga agacttcaag cctcgagatg agttggggat ttgcccatgt 541 aagcacgcct tccacagaaa gtgccttatt aagtggctgg aggttcgtaa agtgtgtccc 601 ctgtgcaaca tgccagttct acagctggcc cagttgcaca gtaagcagga ccgtggaccc 661 cctcaggggc cccttcctgg ggcagagaac attgtatagc ttaccgcaag gatcagactg 721 ttgctggaca cgacgtctgt gtggagccag gaggaacaca tgtggtgtct gtatggctgc 781 tctctaccta ggacaccagc tgccacttct tttgcctcat gaagaactct tgggccagcc 841 aaactgggaa cctaggtgtc tgggtcttgt gacaaccaaa gcactttgac actaccccct 901 gccgagagaa gaggagtgga tgagcctgcg ggtttgcctc aagaaacttc atgagggtct 961 cttactaact ccattacact ctctctcctg gagcctcatc tccatgtcaa gcaggagggt 1021 aaagaaggga actaagagca ggtctttcaa gccacacccc cacctgcgga tggatgggtt 1081 tctctgtagg ccatgcaggc ctttgtcgca gcaaaccttc ccagcagccc ttgagccaag 1141 taaaaccagc acaaccagcc accagtggtt ggtgaggcag tgcccacaag gctcatgttg 1201 tatgcctttg ataaggccat cttggctttg agtagcagtg ttcctcgtca cccatttccc 1261 cctcaggatt acaacacctg ctatcaaatc atctaagctg aaaacatgag atgcgcttgg 1321 aaaggcctag tcagaagcca tttcctctta tcatttccct ctcctatgca ccagtaaggc 1381 ccgtccagag ccccagcagg gagtgggccc tgagtccaca ctgtccctga gtgatccagg 1441 aggctgccca catccccaca tgtgcactgt ggttccagtg tagctgctgt gagcccactg 1501 ccactgcctc agaagggagc cactgtgaac ctctcgag //