LOCUS       AL096778                1538 bp    mRNA    linear   HUM 15-OCT-2008
DEFINITION  Novel human mRNA from chromosome 20, similar to SW:GOLI_DROME
            Q06003 GOLIATH PROTEIN.
ACCESSION   AL096778
VERSION     AL096778.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1538)
  AUTHORS   Stavrides G.S., Huckle E.J., Deloukas P.
  JOURNAL   Submitted (02-JUL-1999) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 681N20 (AL031670).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr20/
            Sanger Centre name : dJ681N20.C20.1
FEATURES             Location/Qualifiers
     source          1..1538
                     /db_xref="H-InvDB:HIT000250144"
                     /organism="Homo sapiens"
                     /chromosome="20"
                     /map="p12.1-13"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..245
                     /number=1
     misc_feature    1..461
                     /note="matches EST AI146409 from clone IMAGE:1685943"
     misc_feature    join(99..180,204..494)
                     /note="matches EST AI094674 from clone IMAGE:1670460"
     misc_feature    245..396
                     /note="matches EST AA510027 from clone 890735"
     exon            246..395
                     /number=2
     CDS             253..699
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9Y225"
                     /db_xref="H-InvDB:HIT000250144.14"
                     /db_xref="HGNC:HGNC:13779"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR040098"
                     /db_xref="PDB:2EP4"
                     /db_xref="UniProtKB/Swiss-Prot:Q9Y225"
                     /protein_id="CAB46627.1"
                     /translation="MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAIFVFILSLLFCC
                     YLIRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHR
                     KCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV"
     misc_feature    388..681
                     /note="matches EST AA152152 from clone 566628"
     exon            396..438
                     /number=3
     exon            439..480
                     /number=4
     exon            481..560
                     /number=5
     exon            561..1538
                     /number=6
     misc_feature    join(709..887,885..919,918..935,941..963)
                     /note="matches EST T65892 from clone 80377"
     misc_feature    join(716..903,895..1004)
                     /note="matches EST AA046136 from clone 376622"
     misc_feature    join(716..1184,1184..1282)
                     /note="matches EST AA478922 from clone 754209"
     misc_feature    join(778..1104,1128..1170)
                     /note="matches EST AA134350 from clone 587757"
     misc_feature    892..1144
                     /note="matches EST AA346290"
     misc_feature    join(1027..1184,1184..1507)
                     /note="matches EST AA431649 from clone 781576"
     misc_feature    1152..1386
                     /note="matches EST AA327926"
     misc_feature    complement(1188..1538)
                     /note="matches EST AI58288 from clone IMAGE:2227857"
     misc_feature    complement(1192..1538)
                     /note="matches EST AA478801 from clone 754209"
     misc_feature    complement(1207..1379)
                     /note="matches EST AI080149 from clone IMAGE:1678539"
     misc_feature    complement(1216..1538)
                     /note="matches EST AA149997 from clone 566628"
     misc_feature    complement(1218..1538)
                     /note="matches EST AI379183 from clone IMAGE:2069577"
     misc_feature    complement(1241..1538)
                     /note="matches EST AA134351 from clone 587757"
     misc_feature    complement(1245..1538)
                     /note="matches EST AI189598 from clone IMAGE:1725454"
     misc_feature    complement(1246..1538)
                     /note="matches EST AI215604 from clone IMAGE:1845023"
     misc_feature    complement(1247..1538)
                     /note="matches EST T65776 from clone 80377"
     misc_feature    complement(1267..1538)
                     /note="matches EST AA431287 from clone 781528"
     misc_feature    complement(1295..1538)
                     /note="matches EST AI040271 from clone IMAGE:1663791"
BASE COUNT          353 a          420 c          412 g          353 t
ORIGIN      
        1 ctggggtttg ggggaccgag ccgctccggg ttcgggatgc tgaggagacc gcgggcccgc
       61 gccagcctcc cacacacaca cactctcccg gcgcctcggc cggccgggcg cggtgtgcag
      121 gggtgaggcg gtgtctccag gctgaggagg gacgcggagg agggtccggc gcggccccgg
      181 gactggaggg tgagtccctc acaaagggcg gagcggggct gtcacctgga gatcacggag
      241 ggaagttcat ccatgagctc ggatttccca cattacaact tcaggatgcc taatattgga
      301 ttccagaatc tgcctctcaa catatatatt gtggtttttg gtactgctat atttgtcttc
      361 atccttagtt tactcttctg ttgctacttg attaggctaa gacatcaagc acacaaagaa
      421 ttttatgcct acaaacaggt tatattaaaa gagaaagtaa aagaattgaa tttacatgag
      481 ctctgtgcag tgtgcctaga agacttcaag cctcgagatg agttggggat ttgcccatgt
      541 aagcacgcct tccacagaaa gtgccttatt aagtggctgg aggttcgtaa agtgtgtccc
      601 ctgtgcaaca tgccagttct acagctggcc cagttgcaca gtaagcagga ccgtggaccc
      661 cctcaggggc cccttcctgg ggcagagaac attgtatagc ttaccgcaag gatcagactg
      721 ttgctggaca cgacgtctgt gtggagccag gaggaacaca tgtggtgtct gtatggctgc
      781 tctctaccta ggacaccagc tgccacttct tttgcctcat gaagaactct tgggccagcc
      841 aaactgggaa cctaggtgtc tgggtcttgt gacaaccaaa gcactttgac actaccccct
      901 gccgagagaa gaggagtgga tgagcctgcg ggtttgcctc aagaaacttc atgagggtct
      961 cttactaact ccattacact ctctctcctg gagcctcatc tccatgtcaa gcaggagggt
     1021 aaagaaggga actaagagca ggtctttcaa gccacacccc cacctgcgga tggatgggtt
     1081 tctctgtagg ccatgcaggc ctttgtcgca gcaaaccttc ccagcagccc ttgagccaag
     1141 taaaaccagc acaaccagcc accagtggtt ggtgaggcag tgcccacaag gctcatgttg
     1201 tatgcctttg ataaggccat cttggctttg agtagcagtg ttcctcgtca cccatttccc
     1261 cctcaggatt acaacacctg ctatcaaatc atctaagctg aaaacatgag atgcgcttgg
     1321 aaaggcctag tcagaagcca tttcctctta tcatttccct ctcctatgca ccagtaaggc
     1381 ccgtccagag ccccagcagg gagtgggccc tgagtccaca ctgtccctga gtgatccagg
     1441 aggctgccca catccccaca tgtgcactgt ggttccagtg tagctgctgt gagcccactg
     1501 ccactgcctc agaagggagc cactgtgaac ctctcgag
//