LOCUS AL080173 2373 bp mRNA linear HUM 15-OCT-2008
DEFINITION Homo sapiens mRNA; cDNA DKFZp434H071 (from clone DKFZp434H071);
partial cds.
ACCESSION AL080173
VERSION AL080173.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2373)
AUTHORS Poustka A., Klein M., Mewes H.W., Gassenhuber J., Wiemann S.
JOURNAL Submitted (16-JUN-1999) to the INSDC. MIPS, Am Klopferspitz 18a,
D-82152 Martinsried, GERMANY
COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
sequenced by DKFZ (German Cancer Research Center,
Heidelberg/Germany) within the cDNA sequencing consortium of
the German Genome Project.
This clone (DKFZp434H071) is available at the RZPD in Berlin.
Please contact the RZPD: Ressourcenzentrum, Heubnerweg 6,
14059 Berlin-Charlottenburg, GERMANY; Email: clone@rzpd.de
Further information about the clone and the sequencing project
is available at http://www.mips.biochem.mpg.de/proj/cDNA/
FEATURES Location/Qualifiers
source 1..2373
/db_xref="H-InvDB:HIT000024294"
/organism="Homo sapiens"
/mol_type="mRNA"
/dev_stage="adult"
/clone_lib="434 (synonym: htes3). Vector pSport1; host
DH10B; sites NotI + SalI"
/clone="DKFZp434H071"
/tissue_type="testis"
/db_xref="taxon:9606"
CDS <1..1352
/codon_start=3
/gene="DKFZp434H071"
/product="hypothetical protein"
/note="similarity to TIF1 (transcription intermediary
factor 1)"
/db_xref="GOA:Q9UIF8"
/db_xref="H-InvDB:HIT000024294.17"
/db_xref="HGNC:HGNC:963"
/db_xref="InterPro:IPR001487"
/db_xref="InterPro:IPR001739"
/db_xref="InterPro:IPR001965"
/db_xref="InterPro:IPR011011"
/db_xref="InterPro:IPR013083"
/db_xref="InterPro:IPR016177"
/db_xref="InterPro:IPR018359"
/db_xref="InterPro:IPR018501"
/db_xref="InterPro:IPR019787"
/db_xref="InterPro:IPR028941"
/db_xref="InterPro:IPR036427"
/db_xref="InterPro:IPR037374"
/db_xref="PDB:2E7O"
/db_xref="PDB:3G0L"
/db_xref="PDB:3Q2F"
/db_xref="PDB:4CUP"
/db_xref="PDB:4CUQ"
/db_xref="PDB:4CUR"
/db_xref="PDB:4CUS"
/db_xref="PDB:4CUT"
/db_xref="PDB:4CUU"
/db_xref="PDB:4IR3"
/db_xref="PDB:4IR4"
/db_xref="PDB:4IR5"
/db_xref="PDB:4IR6"
/db_xref="PDB:4NR9"
/db_xref="PDB:4NRA"
/db_xref="PDB:4NRB"
/db_xref="PDB:4NRC"
/db_xref="PDB:4QC1"
/db_xref="PDB:4QC3"
/db_xref="PDB:4QF3"
/db_xref="PDB:4RVR"
/db_xref="PDB:4XUA"
/db_xref="PDB:4XUB"
/db_xref="PDB:5CQ3"
/db_xref="PDB:5CQ4"
/db_xref="PDB:5CQ5"
/db_xref="PDB:5CQ6"
/db_xref="PDB:5CQ7"
/db_xref="PDB:5CQ8"
/db_xref="PDB:5CQA"
/db_xref="PDB:5CU8"
/db_xref="PDB:5CUA"
/db_xref="PDB:5CUB"
/db_xref="PDB:5CUC"
/db_xref="PDB:5CUD"
/db_xref="PDB:5CUE"
/db_xref="PDB:5CUG"
/db_xref="PDB:5DYU"
/db_xref="PDB:5DYX"
/db_xref="PDB:5E73"
/db_xref="PDB:5E74"
/db_xref="PDB:5E9I"
/db_xref="PDB:5E9K"
/db_xref="PDB:5E9L"
/db_xref="PDB:5E9M"
/db_xref="PDB:5E9Y"
/db_xref="PDB:5L8T"
/db_xref="PDB:5L8U"
/db_xref="PDB:5L96"
/db_xref="PDB:5L97"
/db_xref="PDB:5L98"
/db_xref="PDB:5L99"
/db_xref="PDB:5MGE"
/db_xref="PDB:5MGF"
/db_xref="PDB:5MGG"
/db_xref="PDB:5OR9"
/db_xref="PDB:5ORB"
/db_xref="PDB:5PB7"
/db_xref="PDB:5PB8"
/db_xref="PDB:5PB9"
/db_xref="PDB:5PBA"
/db_xref="PDB:5PBB"
/db_xref="PDB:5PBC"
/db_xref="PDB:5PBD"
/db_xref="PDB:5PBE"
/db_xref="PDB:5PBF"
/db_xref="PDB:5PBG"
/db_xref="PDB:5PBH"
/db_xref="PDB:5PBI"
/db_xref="PDB:5PBJ"
/db_xref="PDB:5PBK"
/db_xref="PDB:5PBL"
/db_xref="PDB:5PBM"
/db_xref="PDB:5PBN"
/db_xref="PDB:5PBO"
/db_xref="PDB:5PBP"
/db_xref="PDB:5PBQ"
/db_xref="PDB:5PBR"
/db_xref="PDB:5PBS"
/db_xref="PDB:5PBT"
/db_xref="PDB:5PBU"
/db_xref="PDB:5PBV"
/db_xref="PDB:5PBW"
/db_xref="PDB:5PBX"
/db_xref="PDB:5PBY"
/db_xref="PDB:5PBZ"
/db_xref="PDB:5PC0"
/db_xref="PDB:5PC1"
/db_xref="PDB:5PC2"
/db_xref="PDB:5PC3"
/db_xref="PDB:5PC4"
/db_xref="PDB:5PC5"
/db_xref="PDB:5PC6"
/db_xref="PDB:5PC7"
/db_xref="PDB:5PC8"
/db_xref="PDB:5PC9"
/db_xref="PDB:5PCA"
/db_xref="PDB:5PCB"
/db_xref="PDB:5PCC"
/db_xref="PDB:5PCD"
/db_xref="PDB:5PCE"
/db_xref="PDB:5PCF"
/db_xref="PDB:5PCG"
/db_xref="PDB:5PCH"
/db_xref="PDB:5PCI"
/db_xref="PDB:5PCJ"
/db_xref="PDB:5PCK"
/db_xref="PDB:5PCL"
/db_xref="PDB:5PCM"
/db_xref="PDB:5PCN"
/db_xref="PDB:5PCO"
/db_xref="PDB:5PCP"
/db_xref="PDB:5PCQ"
/db_xref="PDB:5PCR"
/db_xref="PDB:5PCS"
/db_xref="PDB:5PCT"
/db_xref="PDB:5PCU"
/db_xref="PDB:5PCV"
/db_xref="PDB:5PCW"
/db_xref="PDB:5PCX"
/db_xref="PDB:5PCZ"
/db_xref="PDB:5PD0"
/db_xref="PDB:5PD1"
/db_xref="PDB:5PD2"
/db_xref="PDB:5PD3"
/db_xref="PDB:5PD4"
/db_xref="PDB:5PD5"
/db_xref="PDB:5PD6"
/db_xref="PDB:5PD7"
/db_xref="PDB:5PD8"
/db_xref="PDB:5PD9"
/db_xref="PDB:5PDA"
/db_xref="PDB:5PDB"
/db_xref="PDB:5PDC"
/db_xref="PDB:5PDD"
/db_xref="PDB:5PDE"
/db_xref="PDB:5PDF"
/db_xref="PDB:5PDG"
/db_xref="PDB:5PDH"
/db_xref="PDB:5PDI"
/db_xref="PDB:5PDJ"
/db_xref="PDB:5PDK"
/db_xref="PDB:5PDL"
/db_xref="PDB:5PDM"
/db_xref="PDB:5PDN"
/db_xref="PDB:5PDO"
/db_xref="PDB:5PDP"
/db_xref="PDB:5PDQ"
/db_xref="PDB:5PDR"
/db_xref="PDB:5PDS"
/db_xref="PDB:5PDT"
/db_xref="PDB:5PDU"
/db_xref="PDB:5PDV"
/db_xref="PDB:5PDW"
/db_xref="PDB:5PDX"
/db_xref="PDB:5PDY"
/db_xref="PDB:5PDZ"
/db_xref="PDB:5PE0"
/db_xref="PDB:5PE1"
/db_xref="PDB:5PE2"
/db_xref="PDB:5PE3"
/db_xref="PDB:5PE4"
/db_xref="PDB:5PE5"
/db_xref="PDB:5PE6"
/db_xref="PDB:5PE7"
/db_xref="PDB:5PE8"
/db_xref="PDB:5PE9"
/db_xref="PDB:5PEA"
/db_xref="PDB:5PEB"
/db_xref="PDB:5PEC"
/db_xref="PDB:5PED"
/db_xref="PDB:5PEE"
/db_xref="PDB:5PEF"
/db_xref="PDB:5PEG"
/db_xref="PDB:5PEH"
/db_xref="PDB:5PEI"
/db_xref="PDB:5PEJ"
/db_xref="PDB:5PEK"
/db_xref="PDB:5PEL"
/db_xref="PDB:5PEM"
/db_xref="PDB:5PEN"
/db_xref="PDB:5PEO"
/db_xref="PDB:5PEQ"
/db_xref="PDB:5PER"
/db_xref="PDB:5PES"
/db_xref="PDB:5PET"
/db_xref="PDB:5PEU"
/db_xref="PDB:5PEV"
/db_xref="PDB:5PEW"
/db_xref="PDB:5PEX"
/db_xref="PDB:5PEY"
/db_xref="PDB:5PEZ"
/db_xref="PDB:5PF0"
/db_xref="PDB:5PF1"
/db_xref="PDB:5PF2"
/db_xref="PDB:5PF3"
/db_xref="PDB:5PF4"
/db_xref="PDB:5PF5"
/db_xref="PDB:5PF6"
/db_xref="PDB:5PF7"
/db_xref="PDB:5PF8"
/db_xref="PDB:5PF9"
/db_xref="PDB:5PFA"
/db_xref="PDB:5PFB"
/db_xref="PDB:5PFC"
/db_xref="PDB:5PFD"
/db_xref="PDB:5PFE"
/db_xref="PDB:5PFF"
/db_xref="PDB:5PFG"
/db_xref="PDB:5PFH"
/db_xref="PDB:5PFI"
/db_xref="PDB:5PFJ"
/db_xref="PDB:5PFL"
/db_xref="PDB:5PFM"
/db_xref="PDB:5PFN"
/db_xref="PDB:5PFO"
/db_xref="PDB:5PFP"
/db_xref="PDB:5PFQ"
/db_xref="PDB:5PFR"
/db_xref="PDB:5PFS"
/db_xref="PDB:5PFT"
/db_xref="PDB:5PFU"
/db_xref="PDB:5PFV"
/db_xref="PDB:5PFW"
/db_xref="PDB:5PFX"
/db_xref="PDB:5PFY"
/db_xref="PDB:5PFZ"
/db_xref="PDB:5PG0"
/db_xref="PDB:5PG1"
/db_xref="PDB:5PG2"
/db_xref="PDB:5PG3"
/db_xref="PDB:5PG4"
/db_xref="PDB:5PG5"
/db_xref="PDB:5PG6"
/db_xref="PDB:5PG7"
/db_xref="PDB:5PG8"
/db_xref="PDB:5PG9"
/db_xref="PDB:5PGA"
/db_xref="PDB:5PGB"
/db_xref="PDB:5PGC"
/db_xref="PDB:5PGD"
/db_xref="PDB:5PGE"
/db_xref="PDB:5PGF"
/db_xref="PDB:5PGG"
/db_xref="PDB:5PGH"
/db_xref="PDB:5PGI"
/db_xref="PDB:5PGJ"
/db_xref="PDB:5PGK"
/db_xref="PDB:5PGL"
/db_xref="PDB:5PGN"
/db_xref="PDB:5PGO"
/db_xref="PDB:5PGP"
/db_xref="PDB:5PGQ"
/db_xref="PDB:5PGR"
/db_xref="PDB:5PGS"
/db_xref="PDB:5PGT"
/db_xref="PDB:6FGT"
/db_xref="PDB:6FGU"
/db_xref="PDB:6FH6"
/db_xref="PDB:6FH7"
/db_xref="PDB:6FHQ"
/db_xref="PDB:6FI1"
/db_xref="UniProtKB/Swiss-Prot:Q9UIF8"
/protein_id="CAB45759.1"
/translation="RIIDPEDLKALLKVLHLRGIREKALQKQIQKHLDYITQACLKNK
DVAIIELNENEENQVTRDIVENWSVEEQAMEMDLSVLQQVEDLERRVASASLQVKGWM
CPEPASEREDLVYFEHKSFTKLCKEHDGEFTGEDESSAHALERKSDNPLDIAVTRLAD
LERNIERRIEEDIAPGLRVWRRALSEARSAAQVALCIQQLQKSIAWEKSIMKVYCQIC
RKGDNEELLLLCDGCDKGCHTYCHRPKITTIPDGDWFCPACIAKASGQTLKIKKLHVK
GKKTNESKKGKKVTLTGDTEDEDSASTSSSLKRGNKDLKKRKMEENTSINLSKQESFT
SVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIR
EKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWTDTFKVS"
regulatory 2344..2349
/regulatory_class="polyA_signal_sequence"
polyA_site 2363
BASE COUNT 840 a 368 c 467 g 698 t
ORIGIN
1 ggagaattat tgacccagag gacctaaaag ctttgctcaa agtgctgcat ctcagaggaa
61 taagagaaaa ggcattacaa aaacaaattc agaaacattt ggattatatt actcaagcct
121 gcctcaagaa taaggatgtt gctattattg aactgaatga aaatgaagaa aaccaagtaa
181 ctcgagatat tgtggagaac tggtcagtag aagaacaagc aatggaaatg gatttgagtg
241 tccttcaaca ggtagaagat ctagaaagga gagttgcatc agcaagtttg caagtgaagg
301 gttggatgtg tccagagcct gcatcagaaa gggaggactt ggtatatttt gaacataaat
361 catttactaa attgtgcaag gagcatgatg gagaatttac tggcgaagac gaaagcagtg
421 cacatgcact agaacggaag agtgacaacc ccctagatat agctgtaacc aggctggctg
481 atttggagcg gaacattgaa agaagaattg aagaggatat tgctccaggg ctcagggtat
541 ggagaagggc attatcagaa gctcgcagtg ctgcacaggt agctctgtgc attcagcaat
601 tacagaaatc aatagcatgg gaaaaatcaa ttatgaaagt ttactgccaa atctgtcgaa
661 agggagataa tgaagaactg cttcttcttt gtgatggctg tgacaaaggc tgtcatacct
721 actgccatag acccaagatt acaacaatcc cagatggaga ctggttttgt ccagcttgca
781 ttgctaaggc aagtggtcaa actctaaaaa tcaaaaaact tcatgtcaaa ggaaaaaaga
841 ctaatgagtc aaagaaaggc aagaaggtaa ctttaacagg agatactgaa gatgaagact
901 ctgcatctac aagtagttca ctaaaaagag gaaacaaaga cctcaagaaa agaaaaatgg
961 aggaaaacac ttctattaac ttgtcaaaac aagaaagttt tacttcagtt aagaaaccta
1021 aaagagatga ctccaaggac ctagctcttt gcagtatgat tctgactgaa atggaaactc
1081 atgaggatgc atggcctttt ctacttcctg taaacttgaa acttgttcct ggttataaga
1141 aagttattaa gaagcctatg gatttttcca caattagaga gaaactaagt agtggacagt
1201 atccaaacct tgaaaccttt gctctagatg tcaggcttgt ttttgacaac tgtgaaacat
1261 ttaatgaaga tgattctgat ataggcagag ctggccacaa tatgaggaag tattttgaaa
1321 aaaagtggac agatactttc aaagtgagct gaagttataa taatctcttt atttttttcc
1381 ttctaaacaa ggacaaatga gaccagcaat gtgaactgta tttacataaa cgtgcaaggc
1441 acatacataa tgactttctt tttccttaag tataaaaaaa aagtatcaga agaatgatac
1501 catttttaaa ggcttcattc ctacaacaac caaggccctc ggttattggt ttgtgtgatt
1561 tatcagctaa tttaggtaga acagggaagc acacccaaag aattttcaaa ggaaagggtg
1621 ttatagtgca atagcaatta aaatatatca aatcgcactg aatactcaac accagagctc
1681 taatgtggga aatggttctc ctttccctct caataaatat ctatttttca tttttttact
1741 ttgtagttta ttttttagtg aatgtattta attttatgaa ttatttatga ttaaaccaca
1801 tccagaatct tcgttttctg tgaaaaggaa gaactagaaa attgctttaa atcttgaaaa
1861 tacaaggaat gttttaaaat ataaaacaaa gccaagttaa actgtttaca ctgatgtgct
1921 ataaaagcac caaaaagaaa ctttactgta gagttacaag tacatttata tatatatgtt
1981 gctgcatcac ttgtgtagtt aaattgtatt tcaaaacagt gaaaaaattg acatgtatat
2041 actgttcatt cttgtttata ttaagtcttg ttttaaatat gtattatgtg tatatattgt
2101 ttgcagacat tattgttcat gccttagagg attgtagcat tttattttcg tctgaaggta
2161 atgatagcta tacagtctgt acagtaatta tcctctacca acactgtggc gtctccttaa
2221 tcttggtagt gcctgccttt gaaacagggt gtaggggata ttagttttcc atttttctat
2281 tttgttatat aattttaagc caccagggcc taaattaaag tataatcatt tgtatccatg
2341 tggaataaaa ttgtgacaat ttcaaaaaaa aaa
//