LOCUS AL050163 524 bp mRNA linear HTC 15-OCT-2008 DEFINITION Homo sapiens mRNA; cDNA DKFZp586C1522 (from clone DKFZp586C1522). ACCESSION AL050163 VERSION AL050163.1 KEYWORDS HTC. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 524) AUTHORS Koehrer K., Beyer A., Mewes H.W., Weil B., Amid C., Osanger A., Fobo G., Han M., Wiemann S. CONSRTM The German cDNA Consortium JOURNAL Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter Landstr.1, D-85764 Neuherberg, GERMANY COMMENT Clone from S. Wiemann, Molecular Genome Analysis, German Cancer Research Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de; sequenced by BMFZ (Biomedical Research Center at the Heinrich-Heine-University, Duesseldorf/Germany) within the cDNA sequencing consortium of the German Genome Project. This clone (DKFZp586C1522) is available at the RZPD Deutsches Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany. Please contact RZPD for ordering: http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp586C1522 Further information about the clone and the sequencing project is available at http://mips.gsf.de/projects/cdna/ FEATURES Location/Qualifiers source 1..524 /db_xref="H-InvDB:HIT000024041" /organism="Homo sapiens" /mol_type="mRNA" /dev_stage="adult" /clone_lib="586 (synonym: hute1). Vector pSport1; host DH10B; sites NotI + SalI/MluI" /clone="DKFZp586C1522" /tissue_type="uterus" /note="DNAX-activation protein 10" /db_xref="taxon:9606" CDS 115..396 /codon_start=1 /gene="DKFZp586C1522" /product="hypothetical protein" /db_xref="GOA:Q9UBK5" /db_xref="H-InvDB:HIT000024041.14" /db_xref="HGNC:HGNC:16977" /db_xref="InterPro:IPR009861" /db_xref="UniProtKB/Swiss-Prot:Q9UBK5" /protein_id="CAB43303.2" /translation="MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGS LSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG" BASE COUNT 106 a 176 c 121 g 121 t ORIGIN 1 cttgacacca gcagggtgac atccgctatt gctacttctc tgctccccca cagttcctct 61 ggacttctct ggaccacagt cctctgccag acccctgcca gaccccagtc caccatgatc 121 catctgggtc acatcctctt cctgcttttg ctcccagtgg ctgcagctca gacgactcca 181 ggagagagat catcactccc tgccttttac cctggcactt caggctcttg ttccggatgt 241 gggtccctct ctctgccgct cctggcaggc ctcgtggctg ctgatgcggt ggcatcgctg 301 ctcatcgtgg gggcggtgtt cctgtgcgca cgcccacgcc gcagccccgc ccaagaagat 361 ggcaaagtct acatcaacat gccaggcagg ggctgaccct cctgcagctt ggacctttga 421 cttctgaccc tctcatcctg gatggtgtgt ggtggcacag gaacccccgc cccaactttt 481 ggattgtaat aaaacaattg aaacaccaaa aaaaaaaaaa aaaa //