LOCUS       AL050163                 524 bp    mRNA    linear   HTC 15-OCT-2008
DEFINITION  Homo sapiens mRNA; cDNA DKFZp586C1522 (from clone DKFZp586C1522).
ACCESSION   AL050163
VERSION     AL050163.1
KEYWORDS    HTC.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 524)
  AUTHORS   Koehrer K., Beyer A., Mewes H.W., Weil B., Amid C., Osanger A.,
            Fobo G., Han M., Wiemann S.
  CONSRTM   The German cDNA Consortium
  JOURNAL   Submitted (22-SEP-2004) to the INSDC. MIPS, Ingolstaedter
            Landstr.1, D-85764 Neuherberg, GERMANY
COMMENT     Clone from S. Wiemann, Molecular Genome Analysis, German Cancer
            Research
            Center (DKFZ); Email s.wiemann@dkfz-heidelberg.de;
            sequenced by BMFZ (Biomedical Research Center at the
            Heinrich-Heine-University, Duesseldorf/Germany) within the cDNA
            sequencing consortium of the German Genome Project.
            This clone (DKFZp586C1522) is available at the RZPD Deutsches
            Ressourcenzentrum fuer Genomforschung GmbH in Berlin, Germany.
            Please contact RZPD for ordering:
            http://www.rzpd.de/cgi-bin/products/cl.cgi?CloneID=DKFZp586C1522
            Further information about the clone and the sequencing project is
            available at http://mips.gsf.de/projects/cdna/
FEATURES             Location/Qualifiers
     source          1..524
                     /db_xref="H-InvDB:HIT000024041"
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /dev_stage="adult"
                     /clone_lib="586 (synonym: hute1). Vector pSport1; host
                     DH10B; sites NotI + SalI/MluI"
                     /clone="DKFZp586C1522"
                     /tissue_type="uterus"
                     /note="DNAX-activation protein 10"
                     /db_xref="taxon:9606"
     CDS             115..396
                     /codon_start=1
                     /gene="DKFZp586C1522"
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9UBK5"
                     /db_xref="H-InvDB:HIT000024041.14"
                     /db_xref="HGNC:HGNC:16977"
                     /db_xref="InterPro:IPR009861"
                     /db_xref="UniProtKB/Swiss-Prot:Q9UBK5"
                     /protein_id="CAB43303.2"
                     /translation="MIHLGHILFLLLLPVAAAQTTPGERSSLPAFYPGTSGSCSGCGS
                     LSLPLLAGLVAADAVASLLIVGAVFLCARPRRSPAQEDGKVYINMPGRG"
BASE COUNT          106 a          176 c          121 g          121 t
ORIGIN      
        1 cttgacacca gcagggtgac atccgctatt gctacttctc tgctccccca cagttcctct
       61 ggacttctct ggaccacagt cctctgccag acccctgcca gaccccagtc caccatgatc
      121 catctgggtc acatcctctt cctgcttttg ctcccagtgg ctgcagctca gacgactcca
      181 ggagagagat catcactccc tgccttttac cctggcactt caggctcttg ttccggatgt
      241 gggtccctct ctctgccgct cctggcaggc ctcgtggctg ctgatgcggt ggcatcgctg
      301 ctcatcgtgg gggcggtgtt cctgtgcgca cgcccacgcc gcagccccgc ccaagaagat
      361 ggcaaagtct acatcaacat gccaggcagg ggctgaccct cctgcagctt ggacctttga
      421 cttctgaccc tctcatcctg gatggtgtgt ggtggcacag gaacccccgc cccaactttt
      481 ggattgtaat aaaacaattg aaacaccaaa aaaaaaaaaa aaaa
//