LOCUS       AL049785                 883 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  Novel human gene mapping to chomosome 13.
ACCESSION   AL049785
VERSION     AL049785.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 883)
  AUTHORS   Rhodes S.
  JOURNAL   Submitted (05-MAY-1999) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This cDNA sequence was assembled from public domain ESTs and single
            pass sequencing reads from expressed DNA templates, aligned to the
            genomic DNA sequence from the bacterial clone 92M18 (Z73359).
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr13/
            Experimentally determined gene with isoforms 92M18.C13.1a
            (HS92M181A),
            92M18.C13.1b (HS92M181B) and 92M18.C13.1c (HS92M181C).
            Sanger Centre name : 92M18.C13.1
FEATURES             Location/Qualifiers
     source          1..883
                     /db_xref="H-InvDB:HIT000250089"
                     /organism="Homo sapiens"
                     /chromosome="13"
                     /map="13q12.3"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            1..231
                     /number=1
     misc_feature    128..615
                     /note="matches EST AI378203 from clone IMAGE:2069456"
     misc_feature    128..527
                     /note="matches EST AI279647 from clone IMAGE:1927920"
     misc_feature    join(134..593,805..856)
                     /note="matches EST AA931559 from clone IMAGE:1570190"
     misc_feature    171..231
                     /note="matches EST AA922057 from clone IMAGE:1543986"
     misc_feature    215..525
                     /note="matches EST AA741313 from clone IMAGE:1356598"
     misc_feature    join(219..530,530..551)
                     /note="matches EST AA830633 from clone IMAGE:1353189"
     exon            232..359
                     /number=2
     misc_feature    279..580
                     /note="matches EST AA353983"
     exon            360..448
                     /number=3
     CDS             371..784
                     /product="hypothetical protein"
                     /db_xref="H-InvDB:HIT000250089.13"
                     /db_xref="HGNC:HGNC:25037"
                     /db_xref="InterPro:IPR026302"
                     /db_xref="UniProtKB/TrEMBL:Q9Y273"
                     /protein_id="CAB42443.1"
                     /translation="MRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWK
                     FNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNN
                     ARYWNSYTEFPNRRAHGGFTNESSYHRRGGCHHGY"
     exon            449..525
                     /number=4
     exon            526..807
                     /number=5
     misc_feature    587..721
                     /note="matches EST AA007301 from clone 429238"
     misc_feature    complement(652..811)
                     /note="matches EST AA776774 from clone 1276637"
     misc_feature    complement(805..883)
                     /note="matches EST Z38606 from clone c-0ic01"
                     /note="matches EST AA825349 from clone IMAGE:1416311"
                     /note="matches EST AA487590 from clone 841695"
                     /note="matches EST F02671 from clone c-16e06"
                     /note="matches EST F03825 from clone c-2bc03"
                     /note="matches EST AA988369 from clone IMAGE:1605575"
                     /note="matches EST AA007302 from clone 429238"
                     /note="matches EST R61510 from clone 37787"
                     /note="matches EST N80918 from clone 301370"
                     /note="matches EST AI051820 from clone IMAGE:1648444"
     exon            808..883
                     /number=6
BASE COUNT          256 a          230 c          208 g          189 t
ORIGIN      
        1 cgtgacttca gtaaagggaa cccggggctc tcgcagccag ccctcctgcc catggaggac
       61 agtttccttc aatcttttgg gaggctgagc ctccagcccc agcagcagca gcagcggcag
      121 cggccgcccc ggccgccccc gcgggggtac acctcctcgc cgccacagct ttaggaaaca
      181 cctctacctc ctgcgaggcc tcccgggctc cgggaaaact acactggcca gacaattgca
      241 gcatgacttt cccagggccc tgattttcag cacggatgat tttttcttca gggaagatgg
      301 tgcctatgag ttcaatcctg acttcctgga ggaagctcat gaatggaacc aaaaaagagc
      361 aagaaaagca atgaggaatg gcatatcccc cattattatt gataatacca acctccacgc
      421 ctgggaaatg aagccctatg cagtcatggc acttgaaaat aactatgaag ttatattccg
      481 agaacctgac actcgctgga aattcaacgt tcaagagtta gcaagaagaa acattcatgg
      541 tgtctcaaga gaaaaaatcc accgaatgaa agaacggtat gaacacgatg ttacttttca
      601 cagtgtgctt catgcagaaa agccaagcag aatgaacaga aaccaggaca ggaataatgc
      661 attgccttcc aacaatgcca gatactggaa ttcctacaca gagtttccaa accggagggc
      721 ccacggtgga tttacaaatg agagctccta tcacagaagg ggcggttgtc accatggata
      781 ttagaggcct atcttacagc caggcagatt taatgtgaga tcatgataga caagaccaca
      841 gaggacgtat gctctatttc ttgttggcca acagcttctt tct
//