LOCUS AL049785 883 bp mRNA linear HUM 14-NOV-2006 DEFINITION Novel human gene mapping to chomosome 13. ACCESSION AL049785 VERSION AL049785.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 883) AUTHORS Rhodes S. JOURNAL Submitted (05-MAY-1999) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This cDNA sequence was assembled from public domain ESTs and single pass sequencing reads from expressed DNA templates, aligned to the genomic DNA sequence from the bacterial clone 92M18 (Z73359). The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr13/ Experimentally determined gene with isoforms 92M18.C13.1a (HS92M181A), 92M18.C13.1b (HS92M181B) and 92M18.C13.1c (HS92M181C). Sanger Centre name : 92M18.C13.1 FEATURES Location/Qualifiers source 1..883 /db_xref="H-InvDB:HIT000250089" /organism="Homo sapiens" /chromosome="13" /map="13q12.3" /mol_type="mRNA" /db_xref="taxon:9606" exon 1..231 /number=1 misc_feature 128..615 /note="matches EST AI378203 from clone IMAGE:2069456" misc_feature 128..527 /note="matches EST AI279647 from clone IMAGE:1927920" misc_feature join(134..593,805..856) /note="matches EST AA931559 from clone IMAGE:1570190" misc_feature 171..231 /note="matches EST AA922057 from clone IMAGE:1543986" misc_feature 215..525 /note="matches EST AA741313 from clone IMAGE:1356598" misc_feature join(219..530,530..551) /note="matches EST AA830633 from clone IMAGE:1353189" exon 232..359 /number=2 misc_feature 279..580 /note="matches EST AA353983" exon 360..448 /number=3 CDS 371..784 /product="hypothetical protein" /db_xref="H-InvDB:HIT000250089.13" /db_xref="HGNC:HGNC:25037" /db_xref="InterPro:IPR026302" /db_xref="UniProtKB/TrEMBL:Q9Y273" /protein_id="CAB42443.1" /translation="MRNGISPIIIDNTNLHAWEMKPYAVMALENNYEVIFREPDTRWK FNVQELARRNIHGVSREKIHRMKERYEHDVTFHSVLHAEKPSRMNRNQDRNNALPSNN ARYWNSYTEFPNRRAHGGFTNESSYHRRGGCHHGY" exon 449..525 /number=4 exon 526..807 /number=5 misc_feature 587..721 /note="matches EST AA007301 from clone 429238" misc_feature complement(652..811) /note="matches EST AA776774 from clone 1276637" misc_feature complement(805..883) /note="matches EST Z38606 from clone c-0ic01" /note="matches EST AA825349 from clone IMAGE:1416311" /note="matches EST AA487590 from clone 841695" /note="matches EST F02671 from clone c-16e06" /note="matches EST F03825 from clone c-2bc03" /note="matches EST AA988369 from clone IMAGE:1605575" /note="matches EST AA007302 from clone 429238" /note="matches EST R61510 from clone 37787" /note="matches EST N80918 from clone 301370" /note="matches EST AI051820 from clone IMAGE:1648444" exon 808..883 /number=6 BASE COUNT 256 a 230 c 208 g 189 t ORIGIN 1 cgtgacttca gtaaagggaa cccggggctc tcgcagccag ccctcctgcc catggaggac 61 agtttccttc aatcttttgg gaggctgagc ctccagcccc agcagcagca gcagcggcag 121 cggccgcccc ggccgccccc gcgggggtac acctcctcgc cgccacagct ttaggaaaca 181 cctctacctc ctgcgaggcc tcccgggctc cgggaaaact acactggcca gacaattgca 241 gcatgacttt cccagggccc tgattttcag cacggatgat tttttcttca gggaagatgg 301 tgcctatgag ttcaatcctg acttcctgga ggaagctcat gaatggaacc aaaaaagagc 361 aagaaaagca atgaggaatg gcatatcccc cattattatt gataatacca acctccacgc 421 ctgggaaatg aagccctatg cagtcatggc acttgaaaat aactatgaag ttatattccg 481 agaacctgac actcgctgga aattcaacgt tcaagagtta gcaagaagaa acattcatgg 541 tgtctcaaga gaaaaaatcc accgaatgaa agaacggtat gaacacgatg ttacttttca 601 cagtgtgctt catgcagaaa agccaagcag aatgaacaga aaccaggaca ggaataatgc 661 attgccttcc aacaatgcca gatactggaa ttcctacaca gagtttccaa accggagggc 721 ccacggtgga tttacaaatg agagctccta tcacagaagg ggcggttgtc accatggata 781 ttagaggcct atcttacagc caggcagatt taatgtgaga tcatgataga caagaccaca 841 gaggacgtat gctctatttc ttgttggcca acagcttctt tct //