LOCUS AL049783 2825 bp mRNA linear HUM 15-OCT-2008
DEFINITION Novel human gene mapping to chomosome 13.
ACCESSION AL049783
VERSION AL049783.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2825)
AUTHORS Rhodes S.
JOURNAL Submitted (05-MAY-1999) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to the
genomic DNA sequence from the bacterial clone 130N4 (Z75887).
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr13/
Experimentally determined gene.
Sanger Centre name : 130N4.C13.3
FEATURES Location/Qualifiers
source 1..2825
/db_xref="H-InvDB:HIT000250087"
/organism="Homo sapiens"
/chromosome="13"
/map="13q12.3"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..165
/number=1
exon 166..1424
/number=2
CDS 166..1917
/product="hypothetical protein"
/db_xref="GOA:Q92802"
/db_xref="H-InvDB:HIT000250087.12"
/db_xref="HGNC:HGNC:26916"
/db_xref="InterPro:IPR026302"
/db_xref="InterPro:IPR026568"
/db_xref="InterPro:IPR027417"
/db_xref="UniProtKB/Swiss-Prot:Q92802"
/protein_id="CAB42441.1"
/translation="MSYGEIEGKFLGPREEVTSEPRCKKLKSTTESYVFHNHSNADFH
RIQEKTGNDWVPVTIIDVRGHSYLQENKIKTTDLHRPLHDEMPGNRPDVIESIDSQVL
QEARPPLVSADDEIYSTSKAFIGPIYKPPEKKKRNEGRNEAHVLNGINDRGGQKEKQK
FNSEKSEIDNELFQFYKEIEELEKEKDGFENSCKESEPSQEQFVPFYEGHNNGLLKPD
EEKKDLSNKAMPSHCDYQQNLGNEPDKYPCNGQVIPTFCDTSFTSFRPEWQSVYPFIV
PYGPPLPSLNYHLNIQRFSGPPNPPSNIFQAQDDSQIQNGYYVNNCHVNWNCMTFDQN
NEYTDCSENRSSVHPSGNGCSMQDRYVSNGFCEVRERCWKDHCMDKHNGTDRFVNQQF
QEEKLNKLQKLLILLRGLPGSGKTTLSRILLGQNRDGIVFSTDDYFHHQDGYRYNVNQ
LGDAHDWNQNRAKQAIDQGRSPVIIDNTNIQAWEMKPYVEVAIGKGYRVEFHEPETWW
KFDPEELEKRNKHGVSRKKIAQMLDRYEYQMSISIVMNSVEPSHKSTQRPPPPQGRQR
WGGSLGSHNRVCVTNNH"
misc_feature 297..632
/note="matches EST Z37013 from clone HEA96T"
misc_feature 383..669
/note="matches EST T36294"
misc_feature 416..753
/note="matches EST F08013 from clone c-2nh12"
misc_feature join(416..737,754..770)
/note="matches EST Z43629 from clone c-1gh11"
misc_feature 788..1323
/note="matches EST AA878717 from clone IMAGE:1417897"
misc_feature 1188..1424
/note="matches EST Z35727 from clone HEA10M;"
misc_feature complement(1423..1551)
/note="matches EST AI427170 from clone IMAGE:540682"
misc_feature 1424..1814
/note="matches EST AA458557 from clone 837930"
misc_feature join(1424..1444,1444..1549)
/note="matches EST W19988 from clone 305897"
exon 1425..1549
/number=3
misc_feature 1487..1549
/note="matches EST AA610769 from clone IMAGE:1133996"
misc_feature 1489..1549
/note="matches EST AA355316 "
exon 1550..1638
/number=4
misc_feature complement(1552..2098)
/note="matches EST AA999780 from clone IMAGE:1606885"
misc_feature 1577..2069
/note="matches EST AA478507 from clone 784703"
misc_feature 1591..2010
/note="matches EST H05696 from clone 43905"
misc_feature complement(1609..2098)
/note="matches EST AI276613 from clone IMAGE:1877068"
misc_feature complement(1609..2097)
/note="matches EST AI200576 from clone IMAGE:1758140"
misc_feature complement(1611..2105)
/note="matches EST AA478508 from clone 784703"
misc_feature complement(join(1612..1634,1680..2105))
/note="matches EST AI039308 from clone IMAGE:1658394"
misc_feature join(1613..1946,1941..2036)
/note="matches EST W77731 from clone 345851"
misc_feature complement(1636..2097)
/note="matches EST AA909717 from clone IMAGE:1544199"
misc_feature 1638..1896
/note="matches EST N39935 from clone 257441"
misc_feature complement(join(1638..1742,1739..1789,1784..2103))
/note="matches EST H95240 from clone 234322"
misc_feature 1638..1716
/note="matches EST R98358 from clone 201667"
misc_feature 1638..1718
/note="matches EST AA634635 from clone 841870"
exon 1639..1715
/number=5
misc_feature complement(1639..2105)
/note="matches EST AI241456 from clone IMAGE:1850947"
misc_feature 1646..1977
/note="matches EST T31302"
misc_feature complement(1656..2105)
/note="matches EST AI078147 from clone IMAGE:1676825"
misc_feature 1660..2011
/note="matches EST N45561 from clone 279416"
misc_feature complement(1673..1929)
/note="matches EST H43430 from clone 186958"
misc_feature 1679..1876
/note="matches EST AA442384 from clone 758229"
misc_feature complement(1679..2098)
/note="matches EST AA437303 from clone 758229"
misc_feature complement(1684..2105)
/note="matches EST AI536840 from clone IMAGE:2178949"
misc_feature complement(1693..2098)
/note="matches EST AI369951 from clone IMAGE:2049127"
misc_feature 1703..1814
/note="matches EST R23446 from clone 132074"
exon 1716..2825
/number=6
misc_feature 1741..2193
/note="matches EST W31658 from clone 320278"
misc_feature 1762..2098
/note="matches EST D19650 from clone mm0369."
misc_feature complement(1820..2179)
/note="matches EST AA443057 from clone 837930"
misc_feature 1835..2202
/note="matches EST AA234085 from clone 669185"
misc_feature 1847..2116
/note="matches EST T10436 from clone hbc184"
misc_feature 1978..2251
/note="matches EST AA344470"
misc_feature 2020..2608
/note="matches EST AA461359 from clone 796815"
misc_feature join(2039..2335,2345..2362,2371..2398)
/note="matches EST R70690 from clone 141838"
misc_feature 2039..2474
/note="matches EST R67540 from clone 141934"
misc_feature complement(2043..2105)
/note="matches EST AI077347 from clone IMAGE:1670756"
misc_feature 2193..2429
/note="matches EST N77034 from clone 289677"
misc_feature 2202..2461
/note="matches EST W31944 from clone 320530"
misc_feature 2299..2706
/note="matches EST AA977011 from clone IMAGE:1558714"
misc_feature complement(2341..2825)
/note="matches EST AA975542 from clone IMAGE:1558245"
misc_feature complement(2342..2825)
/note="matches EST AA461183 from clone 796813"
misc_feature complement(2349..2825)
/note="matches EST AI554858 from clone IMAGE:2089638"
misc_feature complement(join(2369..2551,2552..2825))
/note="matches EST AI361828 from clone IMAGE:2021983"
misc_feature complement(2380..2825)
/note="matches EST AI572862 from clone IMAGE:2174200"
misc_feature complement(2388..2825)
/note="matches EST W15582 from clone 320278"
misc_feature complement(join(2406..2432,2491..2682,2668..2825))
/note="matches EST W31207 from clone 320530"
misc_feature complement(2407..2824)
/note="matches EST AI042364 from clone IMAGE:1660894"
misc_feature complement(join(2409..2549,2554..2825))
/note="matches EST AI341858 from clone IMAGE:1947180"
misc_feature complement(2437..2825)
/note="matches EST N59893 from clone 289677"
misc_feature complement(join(2438..2552,2552..2822))
/note="matches EST AI400842 from clone IMAGE:2119280"
misc_feature complement(2668..2825)
/note="matches EST N48712 from clone 279416"
BASE COUNT 929 a 465 c 565 g 866 t
ORIGIN
1 cggaggtgag gtttgttacc gcgattctga gaggtgggct tttagtccct ccagacctcg
61 gctttagtgc tgtctccgct tttctttcac cttcacagag gttcgtgtct tcctaaaaga
121 aggttttatt gggaggtaaa ggtcaatgcg taggggtaga gtaagatgtc ttatggtgaa
181 attgaaggta aattcttggg acctagagaa gaagtaacga gtgagccacg ctgtaaaaaa
241 ttgaagtcaa ccacagagtc gtatgttttt cacaatcata gtaatgctga ttttcacaga
301 atccaagaga aaactggaaa tgattgggtc cctgtgacca tcattgatgt cagaggacat
361 agttatttgc aggagaacaa aatcaaaact acagatttgc atagaccttt gcatgatgag
421 atgcctggta atagaccaga tgttattgaa tccattgatt cacaggtttt acaggaagca
481 cgtcctccat tagtatccgc agacgatgag atatatagca caagtaaagc atttatagga
541 cccatttaca aaccccctga gaaaaagaaa cgtaatgaag ggaggaatga ggcacatgtt
601 ctaaatggta taaatgacag aggaggacaa aaagagaaac agaaatttaa ctctgaaaaa
661 tcagagattg acaatgaatt attccagttt tacaaagaaa ttgaagagct tgaaaaggaa
721 aaagatggtt ttgagaacag ttgtaaagaa tctgaacctt ctcaggaaca atttgttcca
781 ttttatgagg gtcataataa tggtctctta aaacctgatg aagaaaagaa agatcttagt
841 aataaagcta tgccatcaca ttgtgattat cagcagaact tggggaatga gccagacaaa
901 tatccctgta atggacaagt aatacctaca ttttgtgaca cttcatttac ttctttcagg
961 cctgaatggc agtcagtata tccttttata gtgccctatg gtccccctct tcccagtttg
1021 aactatcatt taaacattca gagattcagt ggtccaccaa atccaccatc aaatattttc
1081 caagcccaag atgactctca gatacaaaat ggatattatg taaataattg tcatgttaac
1141 tggaattgca tgacttttga tcagaacaat gaatatactg actgtagtga gaataggagt
1201 agtgttcatc cctctggaaa tggctgcagt atgcaagatc gatatgtgag taatggtttc
1261 tgtgaagtca gagaaagatg ctggaaagat cattgtatgg acaagcataa tggaacagac
1321 aggtttgtga accagcagtt tcaagaggaa aagttaaata aattgcagaa gttacttatt
1381 cttttaagag gtctgcctgg ttctgggaaa acaacattgt ctcgaattct gcttggtcag
1441 aatcgtgatg gcattgtgtt cagcactgat gactattttc accatcaaga tgggtacagg
1501 tataatgtta atcaacttgg tgatgcccat gactggaacc agaacagagc aaaacaagct
1561 atcgatcagg gaagatctcc agttataata gataacacta atatacaagc ttgggaaatg
1621 aagccatatg tggaagtggc cataggaaaa ggatacagag tagagtttca tgaacctgaa
1681 acttggtgga aatttgatcc tgaagaatta gaaaagagga ataaacatgg tgtgtctcga
1741 aagaagattg ctcagatgtt ggatcgttat gaatatcaaa tgtccatttc tattgtaatg
1801 aattcagtgg aaccatcaca caaaagcaca caaagacctc ctcctccaca ggggagacag
1861 aggtggggag gctctcttgg ctcacataat cgtgtctgtg tcacaaataa tcattaaatt
1921 agctattttc agctaacaca tttgttgttg cacttgaaaa agagttagtg agcctgtctt
1981 ggagtttaag tagtttcaaa taaaaaaagg ctacagtgcc tcacaaagga tgttcccagc
2041 aagttgttta aattcccagc aagttgttaa agtgtaaata aaaatatatg aaattgtatt
2101 ttaaatgttt ttatattctc ttgttgtaat actcttggct gttatggaag cacctgagta
2161 atagagtggt gggtaggagc taggatgttt ttctacaatc gaattttaaa ctaatttatc
2221 tattttatag acactattga acagtttttt aatagttcat atctaaatct aacttttcat
2281 aaaactttac ggtttttcct tcactacctt aaatatgcaa gaaatactga cttggtatag
2341 ggtaccttag ttttctctat tcattagaca ggtaaaatta tatttcagct gattgatctg
2401 tgtgacaaaa ttatttctta gctataatca gcacatcact tagttcaaac aaaattcccc
2461 agcaaatgtt agatagtagg tatatcagtc acctggggag ttttcttcat aatatgcata
2521 ttcatcttgt aatgcataca tagttatcat cctccttctc aacccatctc cctaacccca
2581 catgcttgcc agttcttgaa gggataaagt gattctaata atgttttact tctctctgtt
2641 caatttaatg tgatataatt ctagtataaa aatattttgg acagttgctt aacatggtca
2701 taagaggatt tgtactatag aatatcttct agtactaatt tttctgtaga gcaaattata
2761 tttctctcac tggatagttt ttagatgtgt ttcttcatat aaaattaaaa actgagatgg
2821 aattc
//