LOCUS AL049705 1081 bp mRNA linear HUM 15-OCT-2008
DEFINITION Human gene from PAC 262D12, chromosome 1.
ACCESSION AL049705
VERSION AL049705.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1081)
AUTHORS Rhodes S.
JOURNAL Submitted (22-APR-1999) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This sequence was generated from cDNA clones isolated using
sequence from the bacterial clone 262D12 (Z99297) and EST data.
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr1/
Experimentally determined gene with a CpG island.
Sanger Centre name : dJ262D12.C1.2
FEATURES Location/Qualifiers
source 1..1081
/db_xref="H-InvDB:HIT000250085"
/organism="Homo sapiens"
/chromosome="1"
/map="1q23.3-1q24.3"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..62
/number=1
misc_feature 9..338
/note="matches EST T93683 from clone 116992"
misc_feature join(11..214,196..282,282..302,302..350)
/note="matches EST AA248187"
misc_feature join(16..214,196..282)
/note="matches EST AA095822"
CDS 18..404
/product="hypothetical protein"
/db_xref="GOA:O60783"
/db_xref="H-InvDB:HIT000250085.14"
/db_xref="HGNC:HGNC:14049"
/db_xref="InterPro:IPR001209"
/db_xref="PDB:3J9M"
/db_xref="PDB:6NU2"
/db_xref="PDB:6NU3"
/db_xref="UniProtKB/Swiss-Prot:O60783"
/protein_id="CAB41269.1"
/translation="MAAFMLGSLLRTFKQMVPSSASGQVRSHYVDWRMWRDVKRRKMA
YEYADERLRINSLRKNTILPKILQDVADEEIAALPRDSCPVRIRNRCVMTSRPRGVKR
RWRLSRIVFRHLADHGQLSGIQRATW"
misc_feature 19..313
/note="matches EST AA015679 from clone 360362"
misc_feature join(19..52,53..255)
/note="matches EST AA013163 from clone 361006"
misc_feature 23..257
/note="matches EST AA093306"
misc_feature join(30..259,247..481)
/note="matches EST AA445937 from clone 774208"
exon 63..221
/number=2
misc_feature complement(72..575)
/note="matches EST AA777627 from clone 448491"
misc_feature complement(89..666)
/note="matches EST AI335244 from clone IMAGE:2055776"
misc_feature complement(114..234)
/note="matches EST AA243751 from clone 668446"
misc_feature complement(123..557)
/note="matches EST AI032967 from clone IMAGE:1655685"
misc_feature complement(123..666)
/note="matches EST AI027424 from clone IMAGE:1650184"
misc_feature complement(join(136..258,247..671))
/note="matches EST AI269906 from clone IMAGE:1867992"
misc_feature complement(153..664)
/note="matches EST AA579704 from clone IMAGE:1074566"
misc_feature 158..321
/note="matches EST AA773481 from clone 1048056"
misc_feature 197..324
/note="matches EST AA243830 from clone 668446"
misc_feature complement(join(216..406,404..670))
/note="matches EST AI356231 from clone IMAGE:2016893"
exon 222..1081
/number=3
misc_feature complement(229..575)
/note="matches EST AA995030 from clone IMAGE:1626974"
misc_feature complement(join(237..295,297..671))
/note="matches EST AA992926 from clone IMAGE:1624237"
misc_feature complement(237..399)
/note="matches EST AI218445 from clone IMAGE:1845663"
misc_feature complement(238..666)
/note="matches EST AI361064 from clone IMAGE:2010990"
misc_feature complement(249..671)
/note="matches EST AA470634 from clone IMAGE:880991"
misc_feature complement(249..670)
/note="matches EST AI361152 from clone IMAGE:2011108"
misc_feature 251..401
/note="matches EST N91079 from clone 292869"
misc_feature 254..316
/note="matches EST AA906550 from clone IMAGE:1521496"
misc_feature complement(299..671)
/note="matches EST AA708602 from clone 506477"
misc_feature complement(396..677)
/note="matches EST AI582957 from clone IMAGE:2227148"
misc_feature complement(468..666)
/note="matches EST AA854242 from clone IMAGE:1402003"
misc_feature join(525..623,637..659)
/note="matches EST AA585313"
misc_feature 712..832
/note="matches EST AA236076 from clone IMAGE:684276"
misc_feature 794..1046
/note="matches EST D81447"
misc_feature 794..1055
/note="matches EST C15596"
misc_feature join(794..931,930..1056)
/note="matches EST D61251"
misc_feature 970..1081
/note="matches EST AA461133 from clone 796255"
BASE COUNT 301 a 215 c 227 g 338 t
ORIGIN
1 agtttgtagc ggacaacatg gcggccttca tgctgggctc gctgctgcgg acgttcaagc
61 agatggttcc ttcatcagct tcaggccaag ttcgaagtca ctatgtagac tggagaatgt
121 ggcgcgatgt gaagagacga aaaatggcct atgaatacgc agatgagagg ctacgtatta
181 attcactcag gaagaatacc attttgccaa aaattcttca ggatgtggct gatgaagaaa
241 ttgctgccct cccccgggat agctgtcctg ttagaatcag aaatcggtgt gttatgacgt
301 cccgtccgcg tggtgtgaag cggcgctgga ggcttagtcg tatagtcttc cgtcacttag
361 ctgaccatgg gcaactttct gggatccagc gagcgacatg gtaaatgagc tccagaacct
421 attgagcttg cagggaagcc aagcttgcag ttccagcaag caaagatttt ttttaataga
481 ccaaacccta atctctacag gggcccagta cagttgtttg gcctacctga tgctatctct
541 aaactacttt taaaatgaag acatttgggt gtttcatgtc agtgaattat cttttctctt
601 ggacttaaca aacatactgt tcccatacat agtacaaaga gtagcataat aaatattttc
661 tgtgaatgtt ttttataccc tccttttaag tttaatcttt tagtaacata taggggtttt
721 tgtattaaga gcattatttc ataaaatgct atcttataca taatccaact aattgacatg
781 tagctcatgt atggcagttt gtaatcctgg actagctttg ctgacctgca gagctcccct
841 taactattat tgttagataa acagattgga tagcaaggct gctgttctgg attatctaat
901 gctccacttc ttcttgtgat ggctgaacaa aagaaccact aagtgttttc ttgtccatcc
961 ttaagggact ttaaaacaaa ttatgcctct ttaagtcctt gaaagtctcc atctaaagag
1021 gaaaagtttg ttggaacagt atatattccc tatttttatg tttatttaat ccataacaga
1081 a
//