LOCUS AL049701 648 bp mRNA linear HUM 14-NOV-2006 DEFINITION Human gene from PAC 433G19, chromosome 1. ACCESSION AL049701 VERSION AL049701.1 KEYWORDS . SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 648) AUTHORS Rhodes S. JOURNAL Submitted (22-APR-1999) to the INSDC. E-mail contact: humquery@sanger.ac.uk COMMENT This sequence was generated from cDNA clones isolated using sequence from the bacterial clone 433G19 (AL008735) and EST data. The EST sequences listed match this sequence with an identity of at least 95% between the coordinates shown. Further information can be found at http://www.sanger.ac.uk/HGP/Chr1/ Partial, experimentally determined gene of unknown function Isoform of dJ433G19.C1.1, HS433G191. Sanger Centre name : dJ433G19.C1.1a FEATURES Location/Qualifiers source 1..648 /db_xref="H-InvDB:HIT000250081" /organism="Homo sapiens" /chromosome="1" /map="1q24-25" /mol_type="mRNA" /db_xref="taxon:9606" exon <1..49 /number=1 CDS <1..371 /codon_start=3 /product="hypothetical protein" /db_xref="GOA:Q9Y3L8" /db_xref="H-InvDB:HIT000250081.11" /db_xref="InterPro:IPR033185" /db_xref="UniProtKB/TrEMBL:Q9Y3L8" /protein_id="CAB41265.1" /translation="RECGWFLLPVLILFSWWVCTLALSCSRIFPWIVWSGAGTAAAAV ERPAGKMMEEISIMVAYDAHVFSQLHDEDFLTSLVAISKPRSMVPTKKLKKYEKEYQT MRESQLQQEDPMDRYKFVYL" exon 50..263 /number=2 misc_feature 191..241 /note="matches EST AA790944 from clone 1244480" misc_feature complement(260..648) /note="matches EST AI190891 from clone IMAGE:1733980" /note="matches EST AI204241 from clone IMAGE:1744791" misc_feature complement(260..387) /note="matches EST R15602 from clone G520-F." misc_feature 260..325 /note="matches EST D81529" exon 264..356 /number=3 misc_feature complement(283..642) /note="matches EST N54827 from clone 244376" misc_feature complement(join(312..342,338..648)) /note="matches EST N31984 from clone 259430" misc_feature complement(327..648) /note="matches EST AA810823 from clone IMAGE:1318190" misc_feature complement(join(328..385,386..519)) /note="matches EST R15659 from clone H541-F." exon 357..648 /number=4 misc_feature complement(456..647) /note="matches EST N63623 from clone 289107" BASE COUNT 204 a 119 c 160 g 165 t ORIGIN 1 accgggagtg tggctggttt ctgttgcctg ttttgatact cttctcctgg tgggtgtgta 61 cactggcact gagctgcagt aggatttttc cttggatagt ctggtctgga gctgggacag 121 cagctgctgc tgtggaaagg ccagctggca agatgatgga agaaatctcc attatggtag 181 cctatgacgc ccatgttttc agccagctgc acgatgaaga cttcctcact agtctggtgg 241 ccatcagcaa gcccaggtct atggtaccaa ccaagaagct gaagaaatat gagaaagaat 301 atcagacaat gcgagagagt cagctgcaac aggaagaccc aatggataga tacaagtttg 361 tatatttgta ggtaactcca gctgttgcat ttatactggg aatcttcata agaagctgag 421 agaaagagag gggaaaaaga aagtggcttt ctactttcaa aaatgaaaca aaaaggaaaa 481 atggcaaagt actgttttag ctgtgcatgt catatccaca aagactttta gcaggtgaac 541 tgttccaaga ctgacacaag gatgtttcaa acttgcctct gtctgtagaa aatgttaaaa 601 ataccaactc acttggaagg aaaaataaaa atcacaaagg tatattga //