LOCUS       AL049701                 648 bp    mRNA    linear   HUM 14-NOV-2006
DEFINITION  Human gene from PAC 433G19, chromosome 1.
ACCESSION   AL049701
VERSION     AL049701.1
KEYWORDS    .
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 648)
  AUTHORS   Rhodes S.
  JOURNAL   Submitted (22-APR-1999) to the INSDC. E-mail contact:
            humquery@sanger.ac.uk
COMMENT     This sequence was generated from cDNA clones isolated using
            sequence from the bacterial clone 433G19 (AL008735) and EST data.
            The EST sequences listed match this sequence with an identity
            of at least 95% between the coordinates shown.
            Further information can be found at
            http://www.sanger.ac.uk/HGP/Chr1/
            Partial, experimentally determined gene of unknown function
            Isoform of dJ433G19.C1.1, HS433G191.
            Sanger Centre name : dJ433G19.C1.1a
FEATURES             Location/Qualifiers
     source          1..648
                     /db_xref="H-InvDB:HIT000250081"
                     /organism="Homo sapiens"
                     /chromosome="1"
                     /map="1q24-25"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
     exon            <1..49
                     /number=1
     CDS             <1..371
                     /codon_start=3
                     /product="hypothetical protein"
                     /db_xref="GOA:Q9Y3L8"
                     /db_xref="H-InvDB:HIT000250081.11"
                     /db_xref="InterPro:IPR033185"
                     /db_xref="UniProtKB/TrEMBL:Q9Y3L8"
                     /protein_id="CAB41265.1"
                     /translation="RECGWFLLPVLILFSWWVCTLALSCSRIFPWIVWSGAGTAAAAV
                     ERPAGKMMEEISIMVAYDAHVFSQLHDEDFLTSLVAISKPRSMVPTKKLKKYEKEYQT
                     MRESQLQQEDPMDRYKFVYL"
     exon            50..263
                     /number=2
     misc_feature    191..241
                     /note="matches EST AA790944 from clone 1244480"
     misc_feature    complement(260..648)
                     /note="matches EST AI190891 from clone IMAGE:1733980"
                     /note="matches EST AI204241 from clone IMAGE:1744791"
     misc_feature    complement(260..387)
                     /note="matches EST R15602 from clone G520-F."
     misc_feature    260..325
                     /note="matches EST D81529"
     exon            264..356
                     /number=3
     misc_feature    complement(283..642)
                     /note="matches EST N54827 from clone 244376"
     misc_feature    complement(join(312..342,338..648))
                     /note="matches EST N31984 from clone 259430"
     misc_feature    complement(327..648)
                     /note="matches EST AA810823 from clone IMAGE:1318190"
     misc_feature    complement(join(328..385,386..519))
                     /note="matches EST R15659 from clone H541-F."
     exon            357..648
                     /number=4
     misc_feature    complement(456..647)
                     /note="matches EST N63623 from clone 289107"
BASE COUNT          204 a          119 c          160 g          165 t
ORIGIN      
        1 accgggagtg tggctggttt ctgttgcctg ttttgatact cttctcctgg tgggtgtgta
       61 cactggcact gagctgcagt aggatttttc cttggatagt ctggtctgga gctgggacag
      121 cagctgctgc tgtggaaagg ccagctggca agatgatgga agaaatctcc attatggtag
      181 cctatgacgc ccatgttttc agccagctgc acgatgaaga cttcctcact agtctggtgg
      241 ccatcagcaa gcccaggtct atggtaccaa ccaagaagct gaagaaatat gagaaagaat
      301 atcagacaat gcgagagagt cagctgcaac aggaagaccc aatggataga tacaagtttg
      361 tatatttgta ggtaactcca gctgttgcat ttatactggg aatcttcata agaagctgag
      421 agaaagagag gggaaaaaga aagtggcttt ctactttcaa aaatgaaaca aaaaggaaaa
      481 atggcaaagt actgttttag ctgtgcatgt catatccaca aagactttta gcaggtgaac
      541 tgttccaaga ctgacacaag gatgtttcaa acttgcctct gtctgtagaa aatgttaaaa
      601 ataccaactc acttggaagg aaaaataaaa atcacaaagg tatattga
//