LOCUS AL035366 1480 bp mRNA linear HUM 15-OCT-2008
DEFINITION H.sapiens novel gene, similar to mouse Dynein light chain AB010031.
ACCESSION AL035366
VERSION AL035366.1
KEYWORDS .
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1480)
AUTHORS Collins J.E., Huckle E.J.
JOURNAL Submitted (04-FEB-1999) to the INSDC. E-mail contact:
humquery@sanger.ac.uk
COMMENT This cDNA sequence was assembled from public domain ESTs and single
pass sequencing reads from expressed DNA templates, aligned to
genomic
DNA sequence from the bacterial clone 327J16 (AL008583)
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
FEATURES Location/Qualifiers
source 1..1480
/db_xref="H-InvDB:HIT000250056"
/organism="Homo sapiens"
/chromosome="22"
/map="q12.3-13.2"
/mol_type="mRNA"
/tissue_type="Testis"
/db_xref="taxon:9606"
exon 1..82
/number=1
misc_feature 19..321
/note="match: EST AA377964"
misc_feature 19..350
/note="match: EST D31381"
misc_feature 50..364
/note="match: EST AA348039"
exon 83..290
/number=2
misc_feature join(86..129,127..395)
/note="match: EST H14163"
misc_feature join(101..129,127..513)
/note="match: EST AA394030"
misc_feature 127..340
/note="match: EST R11814"
misc_feature join(127..297,296..458,491..531)
/note="match: EST W69844"
misc_feature join(487..554,129..276,601..730)
/note="match: EST AA322956"
CDS 222..539
/product="hypothetical protein"
/db_xref="GOA:O96015"
/db_xref="H-InvDB:HIT000250056.14"
/db_xref="HGNC:HGNC:2955"
/db_xref="InterPro:IPR001372"
/db_xref="InterPro:IPR037177"
/db_xref="UniProtKB/Swiss-Prot:O96015"
/protein_id="CAA23018.1"
/translation="MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACE
KFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVW
KCS"
exon 291..374
/number=3
misc_feature join(318..418,425..473)
/note="match: EST H55197"
exon 375..1480
/number=4
misc_feature 415..724
/note="match: EST AA349185"
misc_feature join(475..509,611..899)
/note="match: EST N42713"
misc_feature join(633..726,723..799)
/note="match: EST W01618"
misc_feature 662..1137
/note="match: EST AA278275"
misc_feature 775..1233
/note="match: EST AA431647"
misc_feature join(785..1090,1090..1125,1206..1241)
/note="match: EST AA039963"
misc_feature 922..1258
/note="match: EST D80885"
/note="match: EST D60515"
misc_feature join(922..1005,1006..1159)
/note="match: EST D60658"
misc_feature 922..1277
/note="match: EST D61302"
misc_feature 925..1192
/note="match: EST D61325"
misc_feature 925..1203
/note="match: EST D80477"
misc_feature join(925..1159,1169..1203,1205..1293)
/note="match: EST D81455"
misc_feature 927..1262
/note="match: EST D60688"
misc_feature complement(join(942..974,1086..1479))
/note="match: EST N32499"
misc_feature complement(989..1480)
/note="match: EST AA725572"
misc_feature complement(join(991..1298,1285..1480))
/note="match: EST AA935522"
misc_feature complement(1006..1096)
/note="match: EST AA039935"
misc_feature complement(1028..1480)
/note="match: EST AI368050"
misc_feature complement(1029..1472)
/note="match: EST AA279050"
misc_feature complement(1035..1475)
/note="match: EST AI074275"
misc_feature complement(1050..1480)
/note="match: EST AI146263"
misc_feature complement(1066..1098)
/note="match: EST AA076579"
misc_feature complement(1078..1480)
/note="match: EST AI084123"
misc_feature complement(1083..1479)
/note="match: EST AI240913"
misc_feature complement(1099..1480)
/note="match: EST AI208576"
misc_feature 1112..1189
/note="match: EST W31319"
misc_feature complement(1150..1471)
/note="match: EST D81033"
misc_feature complement(1284..1480)
/note="match: EST AA427946"
misc_feature complement(1285..1480)
/note="match: multiple EST's "
/note="match: AA625556, AA435541, AA431283"
BASE COUNT 286 a 430 c 425 g 339 t
ORIGIN
1 taagacactc ttgtttcgct ccttgacaac cctggcgggg gttcgctggc tgcggccccg
61 gctccggccc ccgcaggagc agcacccccc ggggaaagac attttctgct cccaccgagt
121 tggcagggcc tgcttcctga atctcctggg tgtgtcttaa ctgccagtcc cagcacctcc
181 tgaaagcccc actctcctcc agtggtcaca gtggaaggat catgggagaa acagaaggga
241 agaaagatga ggctgattat aagcgactgc agaccttccc tctggtcagg cactcggaca
301 tgccagagga gatgcgcgtg gagaccatgg agctatgtgt cacagcctgt gagaaattct
361 ccaacaacaa cgagagcgcc gccaagatga tcaaagagac aatggacaag aagttcggct
421 cctcctggca cgtggtgatc ggcgagggct ttgggtttga gatcacccac gaggtgaaga
481 acctcctcta cctgtacttc gggggcaccc tggctgtgtg cgtctggaag tgctcctgac
541 actctgtccc ctgccccgtc ccctgcaggg ccttttcctg ccactcatct ggggtgggga
601 gcagccctag gcaggtcctg gtttttccaa ggagagttgg ggtcttttct ttttgtcttt
661 gtgtaccagt ttcctgagcc acgcccagtg tgtgaacttg acatctccat ccccaggctc
721 tcaaccgtct ccctcggagt ctcagggtgt ggacggggca gcgggcatgg gtctgtgtgg
781 gagacgtggg gtggggcggt gtgacagggt agaggaggtg ggagatgaga tcttccgcac
841 aggaacacgc cagtccccct ttctccaggg ctgccttccc cttgcatcct gggagcccca
901 ctgccctgcc atccccagta ctgccgggaa gtgtcggccg tccttgtcat tagtggtcat
961 atgaaaatgg ccccaagaag gagatgattc tttcaaggga cacaggcagc ttctctcctt
1021 gtcctctggg gaggtgctga cccctcagaa accccttccc ccaacttgac cccaggctga
1081 acagaccact gcatctcact gggccagcag cccccccagc ccccagcctt ggtggggacc
1141 aagcagcctt tcccgtcccc tcctcgaccc gtacagttga gagccagggg ctggtgtgtg
1201 ggagctgcta cctggcagtt tctcgagggg tcaccgagcc tctggtggga cacctgggca
1261 ggagtgctct caccacgagg ctgcttccgc agggaaccct ggcctgcccg cgacttcgca
1321 tcagggaccg catgctgatt tgtactgctc tctgctgggt tttctatgtt cttttcgagt
1381 gtgggaaaag ggttttagta gaagggtgaa tcgtatttta cacagcggtc ttatttatat
1441 aaatgtcttg gtttttacaa ttaaaatgac caaaaactga
//