LOCUS AL022729 1028 bp mRNA linear HUM 15-OCT-2008
DEFINITION Human gene similar to Z.mays ras-like (X63277) and H.sapiens RAY1
(X79781).
ACCESSION AL022729
VERSION AL022729.1
KEYWORDS GTP binding protein; ras-related.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1028)
AUTHORS Collins J.E., Huckle E.
JOURNAL Submitted (25-MAR-1998) to the INSDC. E-mail contact:
humquery@sanger.ac.uk Clone requests:clonerequest@sanger.ac.uk
COMMENT This sequence was generated by PCR from a pool of cDNA clones
from a foetal brain library.
All matches to EMBL sequences shown 95% or more.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
FEATURES Location/Qualifiers
source 1..1028
/db_xref="H-InvDB:HIT000250034"
/organism="Homo sapiens"
/chromosome="22"
/map="22q13.1"
/mol_type="mRNA"
/db_xref="taxon:9606"
exon 1..403
/number=1
/note="match Z80897 genomic clone E132D12"
misc_feature join(1..203,211..410)
/note="match: 5' EST AA625287 clone 1047444"
misc_feature join(6..207,305..404,401..423)
/note="match: 5' cDNA end AA625427 clone 1047277"
misc_feature 217..286
/note="match: 5' EST W02362 clone 292062"
misc_feature join(237..404,401..516)
/note="match: 5'cDNA end EST AA357013"
CDS 371..928
/product="hypothetical protein"
/db_xref="GOA:Q9BW83"
/db_xref="H-InvDB:HIT000250034.14"
/db_xref="HGNC:HGNC:18626"
/db_xref="InterPro:IPR001806"
/db_xref="InterPro:IPR005225"
/db_xref="InterPro:IPR020849"
/db_xref="InterPro:IPR027417"
/db_xref="InterPro:IPR034112"
/db_xref="UniProtKB/Swiss-Prot:Q9BW83"
/protein_id="CAA18787.1"
/translation="MVKLAAKCILADPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLV
VKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKW
LEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFE
APFHCLAKQFHQLYREKVEVFRALA"
misc_feature 401..542
/note="match: AA829891 clone IMAGE:1415176"
exon 404..480
/number=2
/note="match Z80897 genomic clone E132D12"
misc_feature complement(471..1028)
/note="match: AA838732 clone IMAGE:1404845"
exon 481..540
/number=3
/note="match Z80897 genomic clone E132D12"
misc_feature 482..541
/note="match: 5' EST H55216 clone C22_196"
misc_feature complement(525..1028)
/note="match: AA809074 clone IMAGE:1240704"
misc_feature complement(join(797..1028,534..702))
/note="match: 3' EST N73298 clone 292062"
exon 541..600
/number=4
/note="match Z80897 genomic clone E132D12"
misc_feature complement(join(797..1024,577..604))
/note="match: AA828507 clone IMAGE:1352790"
exon 601..718
/number=5
/note="match Z80897 genomic clone E132D12"
misc_feature complement(626..1028)
/note="match: 3' EST AA676431"
misc_feature complement(639..1028)
/note="match: AA678576 clone 1155799"
misc_feature join(681..791,803..1021)
/note="match: AA809206 clone IMAGE:1233308"
misc_feature 687..1027
/note="match: AA573574 clone IMAGE:916359"
misc_feature join(687..784,803..1027)
/note="match: AA579737 clone IMAGE:916198"
exon 719..828
/number=6
/note="match Z80897 genomic clone E132D12"
misc_feature complement(734..1028)
/note="match: AA688213 clone IMAGE:1220433"
exon 829..1027
/number=7
/note="match Z80897 genomic clone E132D12"
misc_feature complement(829..1028)
/note="match: AA861523 clone IMAGE:1407655"
/note="match:AA565213 clone IMAGE:993292"
misc_feature complement(join(908..1027,829..919))
/note="match: 3' EST T69764 clone 108200"
misc_feature complement(841..1028)
/note="match: 3' EST AA258131 clone IMAGE:687199"
misc_feature 941..1028
/note="match: 3' EST C02284"
BASE COUNT 218 a 304 c 293 g 213 t
ORIGIN
1 accttttatc ggaggagagc cggatcgtcc ttccttgaac cctctgggta gggctgtgct
61 gaggggctgg gcggggagca caggccgtgt ccgctcgctt gcaccttttc agactgccgt
121 gtcaggcctc gagccgggcc cacctggagc cctcccctgc ccacccgccc ccagcgcccg
181 atatccgccc ccggcccaga agggccgggc tcggtcatcc ccagtcccgt cgcggccact
241 gacccttgag atcagccctc ccctccccac cttcccgtcc caggccagcc cagggcccga
301 agcccaccca ctcgcgtctc tagcagccgc tcttgtcctc tgggtacggc tcgcgggagt
361 gttggttacc atggtgaagc tggcagccaa atgcatcctg gcagacccag cagtgggcaa
421 gaccgccctg gcacagatct tccgcagtga tggagcccat ttccagaaaa gctacaccct
481 gacaacagga atggatttgg tggtgaagac agtgccagtt cctgacacgg gagacagtgt
541 ggaactcttc atttttgact ctgctggcaa ggagctgttt tcggaaatgc tggataaatt
601 gtgggagagt cccaatgtct tatgtctcgt ctatgatgtg accaatgaag aatccttcaa
661 caactgcagc aagtggctgg agaaggctcg gtcacaggct ccaggcatct ctctcccagg
721 tgttttagtt gggaacaaga cagacctggc cggcagacga gcagtggact cagctgaggc
781 ccgggcatgg gcgctgggcc agggcctgga atgttttgaa acatccgtga aagagatgga
841 aaacttcgaa gcccctttcc actgccttgc caagcagttc caccagctgt accgggagaa
901 ggtggaggtt ttccgggccc tggcatgacg agctggagca gatcgtgctg cacaaccgga
961 gaagacagaa ttacctctgc tcttttaata tataatgatg gctttaaata aaattaggag
1021 aaaatgtc
//