LOCUS AL009266 1876 bp mRNA linear HUM 15-OCT-2008
DEFINITION H. sapiens cDNA similar to C. elegans RNA binding protein U14946,
Q10572, complete cds.
ACCESSION AL009266
VERSION AL009266.1
KEYWORDS RNA binding protein.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1876)
AUTHORS Collins J.E., Burton J.
JOURNAL Submitted (18-NOV-1997) to the INSDC. E-mail contact:
humquery@sanger.ac.uk Clone requests: clonerequest@sanger.ac.uk
COMMENT This sequence was generated from a cDNA clone isolated using
bacterial clone contigs and genomic sequence of human
chromosome 22, generated by the Sanger Centre chromosome 22
mapping and sequencing groups.
The EST sequences listed match this sequence with an identity
of at least 95% between the coordinates shown.
Further information can be found at
http://www.sanger.ac.uk/HGP/Chr22/
FEATURES Location/Qualifiers
source 1..1876
/db_xref="H-InvDB:HIT000250030"
/organism="Homo sapiens"
/chromosome="22"
/map="q12-13"
/mol_type="mRNA"
/tissue_type="placental"
/db_xref="taxon:9606"
exon 1..193
/number=1
/note="match Z81369 genomic clone 106I20"
misc_feature join(12..223,221..271,270..293)
/note="match: 3' EST D81973 clone c-2la05"
misc_feature join(33..423,934..981)
/note="match: 5' EST N56061 clone J6510"
misc_feature 159..477
/note="match: 5' EST AA244540 clone 679245"
misc_feature 159..299
/note="match: 5' EST R75495 clone 3NHC5171"
CDS 171..1274
/product="hypothetical protein"
/db_xref="GOA:O43251"
/db_xref="H-InvDB:HIT000250030.13"
/db_xref="HGNC:HGNC:9906"
/db_xref="InterPro:IPR000504"
/db_xref="InterPro:IPR012677"
/db_xref="InterPro:IPR017325"
/db_xref="InterPro:IPR025670"
/db_xref="InterPro:IPR034237"
/db_xref="InterPro:IPR035979"
/db_xref="PDB:2CQ3"
/db_xref="UniProtKB/Swiss-Prot:O43251"
/protein_id="CAA15842.1"
/translation="MEKKKMVTQGNQEPTTTPDAMVQPFTTIPFPPPPQNGIPTEYGV
PHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSLTQTEGGAQTDGQQSQTQSS
ENSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFEN
SADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYANGWKLSPVVGAVYGPEL
YAASSFQADVSLGNDAAVPLSGRGGINTYIPLIIPGFPYPTAATTAAAFRGAHLRGRG
RTVYGAVRAVPPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPT
PTMPLPLPLAMELALWRVYTEVATADLPPTEVT"
exon 194..418
/number=2
/note="match Z81369 genomic clone 106I20"
misc_feature join(195..379,375..422,425..569)
/note="match: 3' EST N23176 clone 267670"
misc_feature join(195..422,425..557)
/note="match: 3' EST AA577482 clone IMAGE:1075648"
misc_feature join(195..333,332..388,388..422,425..524)
/note="match: 5' EST H66074 clone 210608"
misc_feature join(195..335,336..422,425..502)
/note="match: 3' EST W61351 clone 341872"
misc_feature join(195..422,425..459)
/note="match: 5' EST R98096 clone 206827"
misc_feature 195..455
/note="match: 3' EST AA280296 clone IMAGE:712715"
misc_feature join(195..287,279..301,297..379,375..412,418..442,
447..464)
/note="match: 3' EST N72967 clone 291820"
misc_feature 195..422
/note="match: 3' EST Z44044 clone c-1rc07"
misc_feature join(357..696,695..853)
/note="match: 5' EST W75346 clone 390877"
exon 419..565
/number=3
/note="match Z81357 genomic clone 41P2"
misc_feature complement(join(425..551,552..927,925..1033))
/note="match: 5' EST AA402524 clone 741203"
misc_feature join(425..645,641..754)
/note="match: 5' EST AA081998 clone 548575"
misc_feature 425..534
/note="match: 3' EST AA362936 clone IMAGE:1010377"
misc_feature complement(join(530..551,552..927,925..1033))
/note="match: 5' EST AA291407 clone 725218"
exon 566..619
/number=4
/note="match Z81357 genomic clone 41P2"
exon 620..712
/number=5
/note="match Z81357 genomic clone 41P2"
misc_feature join(738..1070,675..738,1058..1113)
/note="match: 5' EST AA253750 clone 669831"
misc_feature complement(join(678..733,733..847,925..1033))
/note="match: 5' EST H53695 clone 236125"
misc_feature 678..714
/note="match: 3' EST Z25303 clone B7F03"
misc_feature 695..745
/note="match: 3' EST Z25293 clone B6B04"
exon 713..773
/number=6
/note="match Z81357 genomic clone 41P2"
exon 774..827
/number=7
/note="match Z81357 genomic clone 41P2"
misc_feature 800..1070
/note="match: 3' EST M85812 clone HFBCO27"
exon 828..920
/number=8
/note="match Z81357 genomic clone 41P2"
misc_feature 829..926
/note="match: 3' EST H12785 clone 148765"
misc_feature join(1058..1185,891..1070)
/note="match: 5' EST AA003706 clone 437454"
exon 921..1053
/number=9
/note="match Z81357 genomic clone 41P2"
misc_feature complement(join(925..956,952..1070,1110..1238,1239..1330))
/note="match: 5' EST N32641 clone 267670"
misc_feature complement(join(937..1070,1058..1099,1145..1238,
1239..1352))
/note="match: 5' EST W61350 clone 341872"
misc_feature 975..1289
/note="match: 3' EST C16002 clone 341872"
misc_feature complement(join(997..1025,1057..1395))
/note="match: 3' EST N95026 clone 306551"
misc_feature complement(join(1000..1022,1032..1059,1053..1111,
1099..1356))
/note="match: 3' EST H66029 clone 210608"
misc_feature complement(join(1043..1072,1099..1383))
/note="match: 3' EST R98097 clone 206827"
misc_feature complement(join(1053..1094,1105..1238,1239..1363))
/note="match: 3' EST T97163 clone 121169"
exon 1054..1142
/number=10
/note="match Z81357 genomic clone 41P2"
misc_feature complement(join(1057..1092,1239..1394))
/note="match: 3' EST AA101104 clone 548575"
misc_feature complement(join(1058..1238,1239..1409))
/note="match: 5' EST AA280574 clone IMAGE:712715"
misc_feature join(1135..1191,1058..1136,1182..1372)
/note="match: 5' EST AA179762 clone 612865"
misc_feature complement(join(1058..1093,1110..1212,1210..1238,
1239..1383))
/note="match: 3' EST AA180436 clone 612865"
misc_feature complement(join(1110..1129,1201..1227,1231..1313,
1310..1535))
/note="match: 3' EST H17976 clone 50414"
misc_feature complement(1119..1213)
/note="match: 3' EST T86607 clone 115242"
exon 1143..1215
/number=11
/note="match Z81314 genomic clone 41P2"
exon 1216..1863
/number=12
/note="match Z81314 genomic clone 41P2"
misc_feature complement(join(1219..1238,1239..1527))
/note="match: 3' EST AA451903 clone 786673"
misc_feature complement(1230..1533)
/note="match: 3' EST R45356 clone 35755"
misc_feature complement(1232..1524)
/note="match: 3' EST F04160 clone c-2lb07"
misc_feature complement(1243..1524)
/note="match: 3' EST F03257 clone c-1rc07"
misc_feature complement(1251..1524)
/note="match: 3' EST F04190 clone c-2lh05"
misc_feature complement(1259..1524)
/note="match: 3' EST F04155 clone c-2la05"
misc_feature complement(1364..1533)
/note="match: 3' EST AA230027 clone IMAGE:1010377"
misc_feature 1384..1539
/note="match: 3' EST C05291 clone 3NHC5171"
misc_feature 1624..1870
/note="match: 3' EST T07396 clone HFBEI40"
misc_feature join(1802..1870,1774..1801)
/note="match: 5' EST AA418165 clone 767460"
BASE COUNT 555 a 425 c 455 g 441 t
ORIGIN
1 ctctaaagaa gaaacattag aaagaaaaag gaaggaaaac ggtataaaga gagatcaatt
61 acccaccctt aaatagctag attggggggg gaggggggtg gaaaagaaag ctgtggaggt
121 gtgccccagc acggctgctt tgaaaggttt atcatctatc cgtttggttt atggagaaaa
181 agaaaatggt aactcagggt aaccaggagc cgacaacaac tcctgacgca atggttcagc
241 cttttactac catcccattt ccaccacctc cgcagaatgg aattcccaca gagtatgggg
301 tgccacacac tcaagactat gccggccaga ccggtgagca taacctgaca ctctacggaa
361 gtacgcaagc ccacggggag cagagcagca actcacccag cacacaaaat ggatctctta
421 cgcagacaga aggtggagca cagacagacg gccagcagtc acagacacaa agtagtgaaa
481 attcagagag taaatctacc ccgaaacggc tgcatgtctc taatattcct ttccgcttcc
541 gggaccctga cctccggcag atgtttgggc agtttggcaa aatcctagat gtagaaataa
601 tctttaatga acgtggctct aagggattcg ggttcgtaac tttcgagaat agtgctgatg
661 cagacagggc cagggagaaa ttacacggca ccgtggtaga gggccgtaaa atcgaggtga
721 ataatgctac agcacgtgta atgaccaata agaagatggt cacaccatat gcaaatggtt
781 ggaaattaag cccagtagtt ggagctgtat atggtccgga gttatatgca gcatccagct
841 ttcaagcaga tgtgtcccta ggcaatgatg cagcagtgcc cctatcagga agagggggta
901 tcaacactta cattccttta atcattcctg gcttccctta ccctactgca gccaccacgg
961 cagccgcttt cagaggagcc catttgaggg gcagagggcg gacagtatat ggtgcagtcc
1021 gagcggtacc tccaacagcc atccccgcct atccaggggt ggatatgcag cctacagata
1081 tgcacagcct gctactgcaa ccgcagccac cgctgctgca gccgctgcag ccgcttacag
1141 tgacggttat ggcagggtgt acacagccga cccctaccat gcccttgccc ctgccgctag
1201 ctatggagtt ggcgctgtgg cgagtttata ccgaggtggc tacagccgat ttgcccccta
1261 ctgaagtgac gtgagacccc tgcaaatggg acagcccccc agttcatgag gcctggctat
1321 tgcaatattt actagtagag gaactctata gcaagatgaa gaggaaaaac aaacaaacaa
1381 acaaaaaaaa acacaaaaaa agaaagaata cttttttata cctcactatg ttctttgaat
1441 atgtattttt cctttaaatt tctgccttta attcttttgt tccaaagatt gtgcattttt
1501 ttcttttttt ttttaaactg tggtaaaaaa aaaaaaaaat aatgcatttc catgtctgta
1561 tgtccgtgct tagcttattc tatcaatcac ggaagaggca gtcaaggagg aaggagagac
1621 attaggagcc gataaatgca tctgatcaga aatcagcaga cagaattacc aaagtgtatc
1681 tggtgctgaa tgactggggg acaagcagaa gtggaagaga tctttctgca acaggatatt
1741 cttctagtct tctgagtttc tggtctttga caggcaattc tggttggctg tggctggaat
1801 ccacatgctg atagatagga atttgtgctt acaaagcagg agaattaaaa agacgctttc
1861 ctctcctcct ttagag
//