LOCUS AK315562 1274 bp mRNA linear HTC 24-MAY-2008
DEFINITION Homo sapiens cDNA, FLJ96633, Homo sapiens protease, serine, 23
(SPUVE), mRNA.
ACCESSION AK315562
VERSION AK315562.1
KEYWORDS HTC; HTC_FLI; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1274)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
Goshima,N., Nomura,N. and Isogai,T.
TITLE NEDO functional analysis of protein and research application
project
JOURNAL Unpublished (2008)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC and Biological
Information Research Center (BIRC), AIST; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..1274
/clone="PLACE7003896"
/clone_lib="PLACE7"
/db_xref="H-InvDB:HIT000434428"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="placenta"
CDS 123..1274
/note="Homo sapiens protease, serine, 23 (SPUVE), mRNA"
/protein_id="BAG37938.1"
/translation="MAGIPGLLFLLFFLLCAVGQVSPYSAPWKPTWPAYRLPVVLPQS
TLNLAKPDFGAEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYETLYANGSRTETQVG
IYILSSSGDGAQHRDSGSSGKSRRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTGC
TGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGFLKPKFKDGGRGANDSTSAMPEQMK
FQWIRVKRTHVPKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIGVSPPAKQLPGGR
IHFSGYDNDRPGNLVYRFCDVKDETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWER
KIIGIFSGHQWVDMNGSPQDFNVAVRITPLKYAQICYWIKGNYLDCREG"
BASE COUNT 308 a 339 c 353 g 274 t
ORIGIN
1 actcggctgt gcggcggggc aggcatggga gccgcgcgct ctctcccggc gcccacacct
61 gtctgagcgg cgcagcgagc cgcggcccgg gcagggctgc tcggcgcgga acagtgctcg
121 gcatggcagg gattccaggg ctcctcttcc ttctcttctt tctgctctgt gctgttgggc
181 aagtgagccc ttacagtgcc ccctggaaac ccacttggcc tgcataccgc ctccctgtcg
241 tcttgcccca gtctaccctc aatttagcca agccagactt tggagccgaa gccaaattag
301 aagtatcttc ttcatgtgga ccccagtgtc ataagggaac tccactgccc acttacgaag
361 aggccaagca atatctgtct tatgaaacgc tctatgccaa tggcagccgc acagagacgc
421 aggtgggcat ctacatcctc agcagtagtg gagatggggc ccaacaccga gactcagggt
481 cttcaggaaa gtctcgaagg aagcggcaga tttatggcta tgacagcagg ttcagcattt
541 ttgggaagga cttcctgctc aactaccctt tctcaacatc agtgaagtta tccacgggct
601 gcaccggcac cctggtggca gagaagcatg tcctcacagc tgcccactgc atacacgatg
661 gaaaaaccta tgtgaaagga acccagaagc ttcgagtggg cttcctaaag cccaagttta
721 aagatggtgg tcgaggggcc aacgactcca cttcagccat gcccgagcag atgaaatttc
781 agtggatccg ggtgaaacgc acccatgtgc ccaagggttg gatcaagggc aatgccaatg
841 acatcggcat ggattatgat tatgccctcc tggaactcaa aaagccccac aagagaaaat
901 ttatgaagat tggggtgagc cctcctgcta agcagctgcc agggggcaga attcacttct
961 ctggttatga caatgaccga ccaggcaatt tggtgtatcg cttctgtgac gtcaaagacg
1021 agacctatga cttgctctac cagcaatgcg atgcccagcc aggggccagc gggtctgggg
1081 tctatgtgag gatgtggaag agacagcagc agaagtggga gcgaaaaatt attggcattt
1141 tttcagggca ccagtgggtg gacatgaatg gttccccaca ggatttcaac gtggctgtca
1201 gaatcactcc tctcaaatat gcccagattt gctattggat taaaggaaac tacctggatt
1261 gtagggaggg gtga
//