LOCUS AK315470 724 bp mRNA linear HTC 24-MAY-2008
DEFINITION Homo sapiens cDNA, FLJ96530, highly similar to Homo sapiens
coenzyme Q7 homolog, ubiquinone (yeast) (COQ7), mRNA.
ACCESSION AK315470
VERSION AK315470.1
KEYWORDS HTC; HTC_FLI; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 724)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
Goshima,N., Nomura,N. and Isogai,T.
TITLE NEDO functional analysis of protein and research application
project
JOURNAL Unpublished (2008)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC and Biological
Information Research Center (BIRC), AIST; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..724
/cell_line="NT2"
/cell_type="teratocarcinoma"
/clone="NT2RI2017245"
/clone_lib="NT2RI2"
/db_xref="H-InvDB:HIT000434336"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/note="mRNA from NT2 neuronal precursor cells treated
2-weeks mitotic inhibitor after 5-weeks retinoic acid
(RA) induction."
/note="majorly NT2 neuron"
/organism="Homo sapiens"
CDS 71..724
/note="highly similar to Homo sapiens coenzyme Q7
homolog, ubiquinone (yeast) (COQ7), mRNA"
/protein_id="BAG37856.1"
/translation="MSCAGAAAAPRLWRLRPGARRSLSAYGRRTSVRFRSSGMTLDNI
SRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMV
MFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEED
PEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL"
BASE COUNT 179 a 166 c 223 g 156 t
ORIGIN
1 atcagtccga gccaagggca ctattggcca gttccgttca acgaagtggt tgcttttttt
61 agttccggca atgagttgcg ccggggcggc ggcggctccc cgcctttggc ggctgcgccc
121 gggggcccgg cggtccctct cagcttatgg aagaagaacc agtgtcagat ttcgcagttc
181 aggaatgact ttagacaata tcagtcgggc agctgtggat cgaataatcc gggtggatca
241 tgcaggcgaa tatggagcaa accgcatcta tgccgggcag atggctgtcc tgggtcggac
301 cagcgtcggg ccagtcattc agaaaatgtg ggatcaagaa aaggaccatt tgaaaaagtt
361 caatgagttg atggttatgt tcagggtccg gccaacagtt ctgatgccct tgtggaacgt
421 gctggggttt gcactggggg cggggaccgc cttgctcggg aaggaaggtg ccatggcctg
481 caccgtggcg gtggaagaga gcatagcaca tcactacaac aaccagatca ggacgctgat
541 ggaggaggac cctgaaaaat acgaggaact tcttcagctg ataaagaaat ttcgggatga
601 agagcttgag caccatgaca taggcctcga ccatgatgca gaattggctc cagcctatgc
661 cgtcctgaag agcattatcc aggccggatg cagagtggcg atatatttat cagaaagatt
721 ataa
//