LOCUS AK314687 906 bp mRNA linear HTC 24-MAY-2008
DEFINITION Homo sapiens cDNA, FLJ95539, highly similar to Homo sapiens cutC
copper transporter homolog (E.coli) (CUTC), mRNA.
ACCESSION AK314687
VERSION AK314687.1
KEYWORDS HTC; HTC_FLI; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 906)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
Goshima,N., Nomura,N. and Isogai,T.
TITLE NEDO functional analysis of protein and research application
project
JOURNAL Unpublished (2008)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC and Biological
Information Research Center (BIRC), AIST; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..906
/clone="SKMUS2000487"
/clone_lib="SKMUS2"
/db_xref="H-InvDB:HIT000433553"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="skeletal muscle"
CDS 85..906
/note="highly similar to Homo sapiens cutC copper
transporter homolog (E.coli) (CUTC), mRNA"
/protein_id="BAG37239.1"
/translation="MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERG
GADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKAD
IRLAKLYGADGLVFGALTEDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALET
LLTLGFERVLTSGCDSSALEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGA
TEFHCSARSTRDSGMKFRNSSVAMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV"
BASE COUNT 229 a 181 c 262 g 234 t
ORIGIN
1 gttgacgcgc ttcttagctg gtgcgcgccg gagcccaaat tccaagtgga aactgcaggc
61 gcacgaggga ggaacgcgtg gagcatgaaa aggcaggggg cctcctctga gcgaaaacga
121 gcgcggatac cgtccgggaa ggccggagca gcaaatggat ttctcatgga agtttgtgtt
181 gattcagtgg aatcagctgt gaatgcagaa agaggaggtg ctgatcggat tgaattatgt
241 tctggtttat cagagggggg aactacaccc agcatgggtg tccttcaagt agtgaagcag
301 agtgttcaga tcccagtttt tgtgatgatt cggccacggg gaggtgattt tttgtattca
361 gatcgtgaaa ttgaggtgat gaaggctgac attcgtcttg ccaagcttta tggtgctgat
421 ggtttggttt ttggggcatt gactgaagat ggacacattg acaaagagct gtgtatgtcc
481 cttatggcta tttgccgccc tctgccagtc actttccacc gagcctttga catggttcat
541 gatccaatgg cagctctgga gaccctctta accttgggat ttgaacgcgt gttgaccagt
601 ggatgtgaca gttcagcatt agaagggcta cccctaataa agcgactcat tgagcaggca
661 aaaggcagga ttgtggtaat gccaggaggt ggtataacag acagaaatct acaaaggatc
721 cttgagggtt caggtgctac agaattccac tgttctgctc ggtctactag agactcggga
781 atgaagtttc gaaattcatc tgttgccatg ggagcctcac tttcttgctc agaatattcc
841 ctaaaggtaa cagatgtgac caaagtaagg actttgaatg ctatcgcaaa gaacatcctg
901 gtgtag
//