LOCUS       AK313158                 774 bp    mRNA    linear   HTC 24-MAY-2008
DEFINITION  Homo sapiens cDNA, FLJ93653, Homo sapiens insulin-like growth
            factor binding protein 6 (IGFBP6),mRNA.
ACCESSION   AK313158
VERSION     AK313158.1
KEYWORDS    HTC; HTC_FLI; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 774)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
            Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
            Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
            Goshima,N., Nomura,N. and Isogai,T.
  TITLE     NEDO functional analysis of protein and research application
            project
  JOURNAL   Unpublished (2008)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC and Biological
            Information Research Center (BIRC), AIST; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..774
                     /cell_type="coronary artery smooth muscle cells (HCASMC)"
                     /clone="HCASM2001345"
                     /clone_lib="HCASM2"
                     /db_xref="H-InvDB:HIT000432024"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="primary culture, coronary artery smooth muscle
                     cells"
                     /organism="Homo sapiens"
     CDS             52..774
                     /note="Homo sapiens insulin-like growth factor binding
                     protein 6 (IGFBP6),mRNA"
                     /protein_id="BAG35976.1"
                     /translation="MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGC
                     VEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRG
                     RCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEM
                     GPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRM
                     GKSLPGSPDGNGSSSCPTGSSG"
BASE COUNT          144 a          247 c          264 g          119 t
ORIGIN      
        1 agctgcgctg cgactgctct ggaaggagag gacggggcac aaaccctgac catgaccccc
       61 cacaggctgc tgccaccgct gctgctgctg ctagctctgc tgctcgctgc cagcccagga
      121 ggcgccttgg cgcggtgccc aggctgcggg caaggggtgc aggcgggttg tccagggggc
      181 tgcgtggagg aggaggatgg ggggtcgcca gccgagggct gcgcggaagc tgagggctgt
      241 ctcaggaggg aggggcagga gtgcggggtc tacaccccta actgcgcccc aggactgcag
      301 tgccatccgc ccaaggacga cgaggcgcct ttgcgggcgc tgctgctcgg ccgaggccgc
      361 tgccttccgg cccgcgcgcc tgctgttgca gaggagaatc ctaaggagag taaaccccaa
      421 gcaggcactg cccgcccaca ggatgtgaac cgcagagacc aacagaggaa tccaggcacc
      481 tctaccacgc cctcccagcc caattctgcg ggtgtccaag acactgagat gggcccatgc
      541 cgtagacatc tggactcagt gctgcagcaa ctccagactg aggtctaccg aggggctcaa
      601 acactctacg tgcccaattg tgaccatcga ggcttctacc ggaagcggca gtgccgctcc
      661 tcccaggggc agcgccgagg tccctgctgg tgtgtggatc ggatgggcaa gtccctgcca
      721 gggtctccag atggcaatgg aagctcctcc tgccccactg ggagtagcgg ctaa
//