LOCUS       AK312736                 654 bp    mRNA    linear   HTC 24-MAY-2008
DEFINITION  Homo sapiens cDNA, FLJ93142.
ACCESSION   AK312736
VERSION     AK312736.1
KEYWORDS    HTC; HTC_FLI; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 654)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
            Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
            Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
            Goshima,N., Nomura,N. and Isogai,T.
  TITLE     NEDO functional analysis of protein and research application
            project
  JOURNAL   Unpublished (2008)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC and Biological
            Information Research Center (BIRC), AIST; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..654
                     /clone="PLACE7009789"
                     /clone_lib="PLACE7"
                     /db_xref="H-InvDB:HIT000431602"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="placenta"
     CDS             211..654
                     /protein_id="BAG35607.1"
                     /translation="MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMA
                     MQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTL
                     LERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK"
BASE COUNT          196 a          147 c          158 g          153 t
ORIGIN      
        1 gtccctgcag cgggcgaaag gagcccgggc ctggaggttt gcgtaccggt cgcctggtcc
       61 cggcaccagc gccgcccagt gtggtttccc ataaggaagc tcttcttcct gcttggcttc
      121 cacctttaac ccttccacct gggagcgtcc tctaacacat tcagactaca agtccagacc
      181 caggagagca aggcccagaa agaggtcaaa atggggttta tattttcaaa atctatgaat
      241 gaaagcatga aaaatcaaaa ggagttcatg cttatgaatg ctcgacttca gctggaaagg
      301 cagctcatca tgcagagtga aatgagggaa agacaaatgg ccatgcagat tgcgtggtct
      361 cgggaattcc tcaaatattt tggaactttt tttggccttg cagccatctc tttaacagct
      421 ggagcgatta aaaaaaagaa gccagccttc ctggtcccga ttgttccatt aagctttatc
      481 ctcacctacc agtatgactt gggctatgga acccttttag aaagaatgaa aggtgaagct
      541 gaggacatac tggaaacaga aaagagtaaa ttgcagctgc caagaggaat gatcactttt
      601 gaaagcattg aaaaagccag aaaggaacag agtagattct tcatagacaa atga
//