LOCUS AK312736 654 bp mRNA linear HTC 24-MAY-2008 DEFINITION Homo sapiens cDNA, FLJ93142. ACCESSION AK312736 VERSION AK312736.1 KEYWORDS HTC; HTC_FLI; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 654) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K., Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T., Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S., Goshima,N., Nomura,N. and Isogai,T. TITLE NEDO functional analysis of protein and research application project JOURNAL Unpublished (2008) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC and Biological Information Research Center (BIRC), AIST; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..654 /clone="PLACE7009789" /clone_lib="PLACE7" /db_xref="H-InvDB:HIT000431602" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="placenta" CDS 211..654 /protein_id="BAG35607.1" /translation="MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMA MQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTL LERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK" BASE COUNT 196 a 147 c 158 g 153 t ORIGIN 1 gtccctgcag cgggcgaaag gagcccgggc ctggaggttt gcgtaccggt cgcctggtcc 61 cggcaccagc gccgcccagt gtggtttccc ataaggaagc tcttcttcct gcttggcttc 121 cacctttaac ccttccacct gggagcgtcc tctaacacat tcagactaca agtccagacc 181 caggagagca aggcccagaa agaggtcaaa atggggttta tattttcaaa atctatgaat 241 gaaagcatga aaaatcaaaa ggagttcatg cttatgaatg ctcgacttca gctggaaagg 301 cagctcatca tgcagagtga aatgagggaa agacaaatgg ccatgcagat tgcgtggtct 361 cgggaattcc tcaaatattt tggaactttt tttggccttg cagccatctc tttaacagct 421 ggagcgatta aaaaaaagaa gccagccttc ctggtcccga ttgttccatt aagctttatc 481 ctcacctacc agtatgactt gggctatgga acccttttag aaagaatgaa aggtgaagct 541 gaggacatac tggaaacaga aaagagtaaa ttgcagctgc caagaggaat gatcactttt 601 gaaagcattg aaaaagccag aaaggaacag agtagattct tcatagacaa atga //