LOCUS AK312550 761 bp mRNA linear HTC 24-MAY-2008
DEFINITION Homo sapiens cDNA, FLJ92923, Homo sapiens leucine zipper and
CTNNBIP1 domain containing (LZIC),mRNA.
ACCESSION AK312550
VERSION AK312550.1
KEYWORDS HTC; HTC_FLI; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 761)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
Goshima,N., Nomura,N. and Isogai,T.
TITLE NEDO functional analysis of protein and research application
project
JOURNAL Unpublished (2008)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC and Biological
Information Research Center (BIRC), AIST; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..761
/clone="CTONG3004656"
/clone_lib="CTONG3"
/db_xref="H-InvDB:HIT000431416"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/note="tumor tissue"
/organism="Homo sapiens"
/tissue_type="tongue, tumor tissue"
CDS 189..761
/note="Homo sapiens leucine zipper and CTNNBIP1 domain
containing (LZIC),mRNA"
/protein_id="BAG35447.1"
/translation="MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEE
TKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQ
PGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAI
LSQFEKVSTDLGSGDKILALASFEVEKTKK"
BASE COUNT 261 a 137 c 187 g 176 t
ORIGIN
1 ccgccaggcc agtgccctca gcatctccac cccgaggtgg tttgaacttt gagccttttg
61 tagtcctgat gaataatttc attttcctca agtttatgac actcggaacg tcaagaactg
121 gaggtttgtg caatttgaga ccggtcggca ctgtgcagag atcagagtac taagagacag
181 agattaaaat ggcttccaga ggaaagacag agacaagcaa attaaagcag aatttagaag
241 aacagttgga tagactcatg caacaattac aagatctgga ggaatgcaga gaggaacttg
301 atacagatga atatgaagaa accaaaaagg aaactctgga gcaactaagt gaatttaatg
361 attcactaaa gaaaattatg tctggaaata tgactttggt agatgaacta agtggaatgc
421 agctggctat tcaggcagct atcagccagg cctttaaaac cccagaggtc atcagattgt
481 ttgcaaagaa acaaccaggt cagcttcgga caaggttagc agagatggat agagatctga
541 tggtaggaaa gctggaaaga gacctgtaca ctcaacagaa agtggagata ctaacagctc
601 ttaggaaact tggagagaag ctgactgcag atgatgaggc cttcttgtca gcaaatgcag
661 gtgctatact cagccagttt gagaaagtct ctacagacct tggctctgga gacaaaattc
721 ttgctctggc aagttttgag gttgaaaaaa caaaaaaatg a
//