LOCUS       AK312185                 465 bp    mRNA    linear   HTC 24-MAY-2008
DEFINITION  Homo sapiens cDNA, FLJ92472, Homo sapiens DC2 protein (DC2), mRNA.
ACCESSION   AK312185
VERSION     AK312185.1
KEYWORDS    HTC; HTC_FLI; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 465)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
            Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
            Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
            Goshima,N., Nomura,N. and Isogai,T.
  TITLE     NEDO functional analysis of protein and research application
            project
  JOURNAL   Unpublished (2008)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC and Biological
            Information Research Center (BIRC), AIST; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..465
                     /cell_type="normal mesangial cells (NHMC56046-2)"
                     /clone="MESAN2016566"
                     /clone_lib="MESAN2"
                     /db_xref="H-InvDB:HIT000431051"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="primary culture, normal mesangial cells"
                     /organism="Homo sapiens"
     CDS             16..465
                     /note="Homo sapiens DC2 protein (DC2), mRNA"
                     /protein_id="BAG35118.1"
                     /translation="METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLI
                     TGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFI
                     ILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG"
BASE COUNT          110 a          102 c          109 g          144 t
ORIGIN      
        1 cttgctgcca ccaacatgga gactttgtac cgtgtcccgt tcttagtgct cgaatgtccc
       61 aacctgaagc tgaagaagcc gccctggttg cacatgccgt cggccatgac tgtgtatgct
      121 ctggtggtgg tgtcttactt cctcatcacc ggaggaataa tttatgatgt tattgttgaa
      181 cctccaagtg tcggttctat gactgatgaa catgggcatc agaggccagt agctttcttg
      241 gcctacagag taaatggaca atatattatg gaaggacttg catccagctt cctatttaca
      301 atgggaggtt taggtttcat aatcctggac cgatcgaatg caccaaatat cccaaaactc
      361 aatagattcc ttcttctgtt cattggattc gtctgtgtcc tattgagttt tttcatggct
      421 agagtattca tgagaatgaa actgccgggc tatctgatgg gttag
//