LOCUS AK312185 465 bp mRNA linear HTC 24-MAY-2008 DEFINITION Homo sapiens cDNA, FLJ92472, Homo sapiens DC2 protein (DC2), mRNA. ACCESSION AK312185 VERSION AK312185.1 KEYWORDS HTC; HTC_FLI; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 465) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K., Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T., Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S., Goshima,N., Nomura,N. and Isogai,T. TITLE NEDO functional analysis of protein and research application project JOURNAL Unpublished (2008) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC and Biological Information Research Center (BIRC), AIST; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..465 /cell_type="normal mesangial cells (NHMC56046-2)" /clone="MESAN2016566" /clone_lib="MESAN2" /db_xref="H-InvDB:HIT000431051" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="primary culture, normal mesangial cells" /organism="Homo sapiens" CDS 16..465 /note="Homo sapiens DC2 protein (DC2), mRNA" /protein_id="BAG35118.1" /translation="METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLI TGGIIYDVIVEPPSVGSMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFI ILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG" BASE COUNT 110 a 102 c 109 g 144 t ORIGIN 1 cttgctgcca ccaacatgga gactttgtac cgtgtcccgt tcttagtgct cgaatgtccc 61 aacctgaagc tgaagaagcc gccctggttg cacatgccgt cggccatgac tgtgtatgct 121 ctggtggtgg tgtcttactt cctcatcacc ggaggaataa tttatgatgt tattgttgaa 181 cctccaagtg tcggttctat gactgatgaa catgggcatc agaggccagt agctttcttg 241 gcctacagag taaatggaca atatattatg gaaggacttg catccagctt cctatttaca 301 atgggaggtt taggtttcat aatcctggac cgatcgaatg caccaaatat cccaaaactc 361 aatagattcc ttcttctgtt cattggattc gtctgtgtcc tattgagttt tttcatggct 421 agagtattca tgagaatgaa actgccgggc tatctgatgg gttag //