LOCUS AK312076 433 bp mRNA linear HTC 24-MAY-2008 DEFINITION Homo sapiens cDNA, FLJ92357, Homo sapiens translocase of outer mitochondrial membrane 22 homolog(yeast) (TOMM22), mRNA. ACCESSION AK312076 VERSION AK312076.1 KEYWORDS HTC; HTC_FLI; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 433) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K., Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T., Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S., Goshima,N., Nomura,N. and Isogai,T. TITLE NEDO functional analysis of protein and research application project JOURNAL Unpublished (2008) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC and Biological Information Research Center (BIRC), AIST; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..433 /clone="SKMUS2000592" /clone_lib="SKMUS2" /db_xref="H-InvDB:HIT000430942" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="skeletal muscle" CDS 5..433 /note="Homo sapiens translocase of outer mitochondrial membrane 22 homolog(yeast) (TOMM22), mRNA" /protein_id="BAG35012.1" /translation="MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETL SERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFE TEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI" BASE COUNT 94 a 111 c 138 g 90 t ORIGIN 1 agtcatggct gccgccgtcg ctgctgccgg tgcaggggaa ccccagtccc cggacgaatt 61 gctcccgaaa ggcgacgcgg agaagcctga ggaggagctg gaggaggacg acgatgagga 121 gctagatgag accctgtcgg agagactatg gggcctgacg gagatgtttc cggagagggt 181 ccggtccgcg gccggagcca cttttgatct ttccctcttt gtggctcaga aaatgtacag 241 gttttccagg gcagccttgt ggattgggac cacttccttt atgatcctgg ttcttcccgt 301 tgtctttgag acggagaagt tgcaaatgga gcaacagcag caactgcagc agcggcagat 361 acttctagga cctaacacag ggctctcagg aggaatgcca ggggctctac cctcacttcc 421 tggaaagatc tag //