LOCUS       AK312076                 433 bp    mRNA    linear   HTC 24-MAY-2008
DEFINITION  Homo sapiens cDNA, FLJ92357, Homo sapiens translocase of outer
            mitochondrial membrane 22 homolog(yeast) (TOMM22), mRNA.
ACCESSION   AK312076
VERSION     AK312076.1
KEYWORDS    HTC; HTC_FLI; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 433)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
            Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
            Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
            Goshima,N., Nomura,N. and Isogai,T.
  TITLE     NEDO functional analysis of protein and research application
            project
  JOURNAL   Unpublished (2008)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC and Biological
            Information Research Center (BIRC), AIST; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..433
                     /clone="SKMUS2000592"
                     /clone_lib="SKMUS2"
                     /db_xref="H-InvDB:HIT000430942"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="skeletal muscle"
     CDS             5..433
                     /note="Homo sapiens translocase of outer mitochondrial
                     membrane 22 homolog(yeast) (TOMM22), mRNA"
                     /protein_id="BAG35012.1"
                     /translation="MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETL
                     SERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFE
                     TEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKI"
BASE COUNT           94 a          111 c          138 g           90 t
ORIGIN      
        1 agtcatggct gccgccgtcg ctgctgccgg tgcaggggaa ccccagtccc cggacgaatt
       61 gctcccgaaa ggcgacgcgg agaagcctga ggaggagctg gaggaggacg acgatgagga
      121 gctagatgag accctgtcgg agagactatg gggcctgacg gagatgtttc cggagagggt
      181 ccggtccgcg gccggagcca cttttgatct ttccctcttt gtggctcaga aaatgtacag
      241 gttttccagg gcagccttgt ggattgggac cacttccttt atgatcctgg ttcttcccgt
      301 tgtctttgag acggagaagt tgcaaatgga gcaacagcag caactgcagc agcggcagat
      361 acttctagga cctaacacag ggctctcagg aggaatgcca ggggctctac cctcacttcc
      421 tggaaagatc tag
//