LOCUS       AK312030                 540 bp    mRNA    linear   HTC 24-MAY-2008
DEFINITION  Homo sapiens cDNA, FLJ92306, Homo sapiens mal, T-cell
            differentiation protein 2 (MAL2), mRNA.
ACCESSION   AK312030
VERSION     AK312030.1
KEYWORDS    HTC; HTC_FLI; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 540)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K.,
            Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T.,
            Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S.,
            Goshima,N., Nomura,N. and Isogai,T.
  TITLE     NEDO functional analysis of protein and research application
            project
  JOURNAL   Unpublished (2008)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC and Biological
            Information Research Center (BIRC), AIST; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..540
                     /clone="FCBBF3000163"
                     /clone_lib="FCBBF3"
                     /db_xref="H-InvDB:HIT000430896"
                     /db_xref="taxon:9606"
                     /dev_stage="fetal"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="brain"
     CDS             10..540
                     /note="Homo sapiens mal, T-cell differentiation protein 2
                     (MAL2), mRNA"
                     /protein_id="BAG34967.1"
                     /translation="MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEI
                     LFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLD
                     FAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTT
                     ACYGCSLGLALRRWRP"
BASE COUNT           92 a          158 c          130 g          160 t
ORIGIN      
        1 tgcggcagca tgtcggccgg cggagcgtca gtcccgccgc ccccgaaccc cgccgtgtcc
       61 ttcccgccgc cccgggtcac cctgcccgcc ggccccgaca tcctgcggac ctactcgggc
      121 gccttcgtct gcctggagat tctgttcggg ggtcttgtct ggattttggt tgcctcctcc
      181 aatgttcctc tacctctact acaaggatgg gtcatgtttg tgtccgtgac agcgtttttc
      241 ttttcgctcc tctttctggg catgttcctc tctggcatgg tggctcaaat tgatgctaac
      301 tggaacttcc tggattttgc ctaccatttt acagtatttg tcttctattt tggagccttt
      361 ttattggaag cagcagccac atccctgcat gatttgcatt gcaatacaac cataaccggg
      421 cagccactcc tgagtgataa ccagtataac ataaacgtag cagcctcaat ttttgccttt
      481 atgacgacag cttgttatgg ttgcagtttg ggtctggctt tacgaagatg gcgaccgtaa
//