LOCUS AK312030 540 bp mRNA linear HTC 24-MAY-2008 DEFINITION Homo sapiens cDNA, FLJ92306, Homo sapiens mal, T-cell differentiation protein 2 (MAL2), mRNA. ACCESSION AK312030 VERSION AK312030.1 KEYWORDS HTC; HTC_FLI; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 540) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (11-JAN-2008) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Kaida,T., Tsuchiya,K., Iida,Y., Takayama,Y., Murakawa,K., Kanehori,K., Andoh,T., Kagawa,N., Sato,R., Kawamura,Y., Tanaka,S., Kisu,Y., Sugano,S., Goshima,N., Nomura,N. and Isogai,T. TITLE NEDO functional analysis of protein and research application project JOURNAL Unpublished (2008) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC and Biological Information Research Center (BIRC), AIST; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..540 /clone="FCBBF3000163" /clone_lib="FCBBF3" /db_xref="H-InvDB:HIT000430896" /db_xref="taxon:9606" /dev_stage="fetal" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="brain" CDS 10..540 /note="Homo sapiens mal, T-cell differentiation protein 2 (MAL2), mRNA" /protein_id="BAG34967.1" /translation="MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEI LFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLD FAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTT ACYGCSLGLALRRWRP" BASE COUNT 92 a 158 c 130 g 160 t ORIGIN 1 tgcggcagca tgtcggccgg cggagcgtca gtcccgccgc ccccgaaccc cgccgtgtcc 61 ttcccgccgc cccgggtcac cctgcccgcc ggccccgaca tcctgcggac ctactcgggc 121 gccttcgtct gcctggagat tctgttcggg ggtcttgtct ggattttggt tgcctcctcc 181 aatgttcctc tacctctact acaaggatgg gtcatgtttg tgtccgtgac agcgtttttc 241 ttttcgctcc tctttctggg catgttcctc tctggcatgg tggctcaaat tgatgctaac 301 tggaacttcc tggattttgc ctaccatttt acagtatttg tcttctattt tggagccttt 361 ttattggaag cagcagccac atccctgcat gatttgcatt gcaatacaac cataaccggg 421 cagccactcc tgagtgataa ccagtataac ataaacgtag cagcctcaat ttttgccttt 481 atgacgacag cttgttatgg ttgcagtttg ggtctggctt tacgaagatg gcgaccgtaa //