LOCUS AK302840 931 bp mRNA linear HUM 24-JUL-2008 DEFINITION Homo sapiens cDNA FLJ52292 complete cds, highly similar to Ubiquinol-cytochrome-c reductase complex coreprotein I, mitochondrial precursor (EC 1.10.2.2). ACCESSION AK302840 VERSION AK302840.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 931) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..931 /clone="TESTI4034469" /clone_lib="TESTI4" /db_xref="H-InvDB:HIT000497464" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="testis" CDS 416..700 /codon_start=1 /note="highly similar to Ubiquinol-cytochrome-c reductase complex coreprotein I, mitochondrial precursor (EC 1.10.2.2)" /protein_id="BAG64031.1" /transl_table=1 /translation="MGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDS QIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVR" BASE COUNT 179 a 222 c 307 g 223 t ORIGIN 1 gactgcagct ggaagatggc ggcgtccgtg gtctgtcggg ccgctaccgc cggggcacaa 61 gtgctattgc gcgcccgccg ctcggtgagg tggtggcgag agcgcggggc ttcgggacag 121 ggcttcggga agcggacagc cggccctgct gcggacgcca gccttgcgga gtacggcaac 181 cttcgctcag gcgctccagt tcgtgccgga gacgcaggtt agcctgctgg acaacggcct 241 gcgtgtggcc tccgagcagt cctctcagcc cacttgcacg gtgggagtgt ggattgatgt 301 tggcagccgt tttgagactg agaagaataa tggggcaggc tactttttgg agcatctggc 361 tttcaaggga acaaagaatc ggcctggcag tgccctggag aaggaggtgg agagcatggg 421 ggcccatctt aatgcctaca gcacccggga gcacacagct tactacatca aggcgctgtc 481 caaggatctg ccgaaagctg tggagctcct gggtgacatt gtgcagaact gtagtctgga 541 agactcacag attgagaagg aacgtgatgt gatcctgcgg gagatgcagg agaatgatgc 601 atctatgcga gatgtggtct ttaactacct gcatgccaca gcattccagg gcacacctct 661 agcccaggct gtggaggggc ccagtgagaa tgtcaggtga gagttggctg gccttgtggg 721 gggatgcttg ctccattctg gcctggccag accctttcca ggtcacattt ttagttggct 781 agctgtcggg gttattttcc tgagttatgc aactggagac agtttctgta tccatgtggt 841 ccagtgagtc ttttttaatg gctttgtggg cttcacttga attttgggct ttgttttaag 901 gtatgttttg gtgcatgtcc tgacagtcca a //