LOCUS       AK302840                 931 bp    mRNA    linear   HUM 24-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ52292 complete cds, highly similar to
            Ubiquinol-cytochrome-c reductase complex coreprotein I,
            mitochondrial precursor (EC 1.10.2.2).
ACCESSION   AK302840
VERSION     AK302840.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 931)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..931
                     /clone="TESTI4034469"
                     /clone_lib="TESTI4"
                     /db_xref="H-InvDB:HIT000497464"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="testis"
     CDS             416..700
                     /codon_start=1
                     /note="highly similar to Ubiquinol-cytochrome-c reductase
                     complex coreprotein I, mitochondrial precursor (EC
                     1.10.2.2)"
                     /protein_id="BAG64031.1"
                     /transl_table=1
                     /translation="MGAHLNAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDS
                     QIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVR"
BASE COUNT          179 a          222 c          307 g          223 t
ORIGIN      
        1 gactgcagct ggaagatggc ggcgtccgtg gtctgtcggg ccgctaccgc cggggcacaa
       61 gtgctattgc gcgcccgccg ctcggtgagg tggtggcgag agcgcggggc ttcgggacag
      121 ggcttcggga agcggacagc cggccctgct gcggacgcca gccttgcgga gtacggcaac
      181 cttcgctcag gcgctccagt tcgtgccgga gacgcaggtt agcctgctgg acaacggcct
      241 gcgtgtggcc tccgagcagt cctctcagcc cacttgcacg gtgggagtgt ggattgatgt
      301 tggcagccgt tttgagactg agaagaataa tggggcaggc tactttttgg agcatctggc
      361 tttcaaggga acaaagaatc ggcctggcag tgccctggag aaggaggtgg agagcatggg
      421 ggcccatctt aatgcctaca gcacccggga gcacacagct tactacatca aggcgctgtc
      481 caaggatctg ccgaaagctg tggagctcct gggtgacatt gtgcagaact gtagtctgga
      541 agactcacag attgagaagg aacgtgatgt gatcctgcgg gagatgcagg agaatgatgc
      601 atctatgcga gatgtggtct ttaactacct gcatgccaca gcattccagg gcacacctct
      661 agcccaggct gtggaggggc ccagtgagaa tgtcaggtga gagttggctg gccttgtggg
      721 gggatgcttg ctccattctg gcctggccag accctttcca ggtcacattt ttagttggct
      781 agctgtcggg gttattttcc tgagttatgc aactggagac agtttctgta tccatgtggt
      841 ccagtgagtc ttttttaatg gctttgtggg cttcacttga attttgggct ttgttttaag
      901 gtatgttttg gtgcatgtcc tgacagtcca a
//