LOCUS AK301191 917 bp mRNA linear HUM 21-JAN-2009
DEFINITION Homo sapiens cDNA FLJ58892 complete cds, highly similar to Homo
sapiens scotin (SCOTIN), mRNA.
ACCESSION AK301191
VERSION AK301191.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 917)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..917
/clone="SPLEN2025719"
/clone_lib="SPLEN2"
/db_xref="H-InvDB:HIT000495815"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="spleen"
CDS 376..792
/codon_start=1
/note="highly similar to Homo sapiens scotin (SCOTIN),
mRNA"
/protein_id="BAH13428.1"
/transl_table=1
/translation="MSGFGATLAVGLTIFVLSVVTIIICFTCSCCCLYKTCRRPRPVV
TTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTMPPQPGMPAAPYPMQYPPPYPAQPM
GPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL"
BASE COUNT 150 a 288 c 247 g 232 t
ORIGIN
1 gtaacttcat cctgttgtgg tcagagaaga tcctttgtat ggtatctgtc ttctaaaatc
61 tgctgagact tgttttgtgg cctaacatat gttctctcct ggagacagtc tggtggacac
121 ctgagaggat gtgtggcttt gtgctatgag atcccggtgt gggcagagtc cacctctgga
181 aggccattga agccaccggt tcatagtagc ttctgtgcac gttttgtggt gccctaaggt
241 agtgtttgtg ctggcgctcg gtggggcttc attgtgctaa tcacaaggtt tcctgtttgc
301 agcgtgcctg ccagtgtaga gccggtggag cagctgggct cggcgctgag gtttcgccct
361 ggctacaacg accccatgtc agggttcgga gcgaccttgg ccgttggcct gaccatcttt
421 gtgctgtctg tcgtcactat catcatctgc ttcacctgct cctgctgctg cctttacaag
481 acgtgccgcc gaccacgtcc ggttgtcacc accaccacat ccaccactgt ggtgcatgcc
541 ccttatcctc agcctccaag tgtgccgccc agctaccctg gaccaagcta ccagggctac
601 cacaccatgc cgcctcagcc agggatgcca gcagcaccct acccaatgca gtacccacca
661 ccttacccag cccagcccat gggcccaccg gcctaccacg agaccctggc tggaggagca
721 gccgcgccct accccgccag ccagcctcct tacaacccgg cctacatgga tgccccgaag
781 gcggccctct gagcattccc tggcctctct ggctgccact tggttatgtt gtgtgtgtgc
841 gtgagtggtg tgcaggcgcg gttccttacg ccccatgtgt gctgtgtgtg tcctgcctgt
901 atatgtggct tcctctg
//