LOCUS AK301133 1013 bp mRNA linear HUM 24-JUL-2008
DEFINITION Homo sapiens cDNA FLJ58429 complete cds.
ACCESSION AK301133
VERSION AK301133.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1013)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..1013
/clone="SPLEN2016579"
/clone_lib="SPLEN2"
/db_xref="H-InvDB:HIT000495757"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="spleen"
CDS 20..589
/codon_start=1
/protein_id="BAG62725.1"
/transl_table=1
/translation="MVRCVPSAVIVCFLRPPQPGRTVIFHDVAVLTDKLFPIVEAMQK
HFSAGLGTYYSDSIFFLSVAMHQIMPKEILQIIQLDLDLKFKTNIRELFEEFDSFLPG
AIIGIAREMQQLADKYHFRGHLGDQDFFTMIGMEHPKLFHVLDCTWNRQLCTWWRDHG
YSDVFEAYFRCEGHVKIYHGNCNTPIPED"
BASE COUNT 223 a 287 c 279 g 224 t
ORIGIN
1 ctctctgtcc tgctgcacta tggtgagatg tgtcccttcc gccgtgattg tgtgtttcct
61 gaggcctccc cagccaggca gaactgtcat cttccacgat gttgctgtgc tgacggataa
121 gctcttcccc atcgtggagg ccatgcagaa gcacttcagt gctggcttgg gaacctacta
181 cagtgactcc atcttcttcc tctcggtcgc catgcatcag atcatgccca aagagatcct
241 gcagatcatt cagctggacc tagacctgaa gtttaagacc aacatccggg agttgtttga
301 ggaatttgac agtttcctgc caggcgccat catcggcata gcccgggaga tgcagcagct
361 ggccgacaag taccacttcc gcggccacct cggggaccag gacttcttca ccatgatcgg
421 catggagcac cccaagctct tccatgtgct ggactgtacc tggaaccggc agctgtgcac
481 ctggtggagg gaccatggct acagtgacgt cttcgaggcc tatttcaggt gtgagggcca
541 cgtcaagatc taccacggga actgcaacac tcccatcccg gaggactagg cgctccccgt
601 gccttgcccc cggggcctcc agatctgggg gaaggacagg gttccttggg acagacccaa
661 gggcagtgtc tgacccgcta gagagacacc gcagggaagt cctgtgatta aggtgctgag
721 acctcctgcc gggcaggtca ctgtgctgag gccacccgcc aaggactggc ctgtgcactg
781 ctggtgcttg ggaccttatt cctccaggga gcaggcgaca caaaggacac gcatgtccag
841 tgggctggga agcaagcact tgaagagaag gaaggggaga aagggtcccc cttgctgtct
901 gcctctgagg aatggaaatc ctttagaccc ggcctttttt ggaccaatat aaatttaatt
961 taaattgaca gccttccatt tttcaagaaa gtacaaacag aactgcttta gca
//