LOCUS       AK300597                 993 bp    mRNA    linear   HUM 31-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ53658 complete cds, highly similar to
            Transmembrane BAX inhibitor motif-containing protein 1.
ACCESSION   AK300597
VERSION     AK300597.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 993)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..993
                     /cell_type="pulmonary artery endothelial cells (HPAEC)"
                     /clone="PUAEN2002805"
                     /clone_lib="PUAEN2"
                     /db_xref="H-InvDB:HIT000495221"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="primary culture, pulmonary artery endothelial
                     cells"
                     /organism="Homo sapiens"
     CDS             80..727
                     /codon_start=1
                     /note="highly similar to Transmembrane BAX inhibitor
                     motif-containing protein 1"
                     /protein_id="BAG62294.1"
                     /transl_table=1
                     /translation="MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQ
                     PGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKG
                     TCQRLCEEKCGCLLRVLCCLRCHLPDPCLLPGTQTPFPMEHHSADPFYFCHGLHDGHH
                     FQYVPNQSRHHCNDHHCGGIHFSHHLLLSDQGGLHLVHRPLLCPGNCAPGDWDCH"
BASE COUNT          194 a          325 c          243 g          231 t
ORIGIN      
        1 actccgaggc caggaacgct ccgtctggaa cggcgcaggt cccagcagct ggggtttccc
       61 cctcagcccg tgagcagcca tgtccaaccc cagcgcccca ccaccatatg aagaccgcaa
      121 ccccctgtac ccaggccctc cgccccctgg gggctatggg cagccatctg tcctgccagg
      181 agggtatcct gcctaccctg gctacccaca gcctggctac ggtcaccctg ctggctaccc
      241 acagcccatg ccccccaccc acccgatgcc catgaactac ggcccaggcc atggctatga
      301 tggggaggag agagcggtga gtgatagctt cgggcctgga gagtgggatg accggaaagt
      361 gcgacacact tttatccgaa agggaacctg tcagcgcctt tgtgaggaga aatgtggctg
      421 tctactacgt gtcctatgct gtcttcgttg tcacctacct gatccttgcc tgctgccagg
      481 gacccagacg ccgtttccca tggaacatca ttctgctgac cctttttact tttgccatgg
      541 gcttcatgac gggcaccatt tccagtatgt accaaaccaa agccgtcatc attgcaatga
      601 tcatcactgc ggtggtatcc atttcagtca ccatcttctg ctttcagacc aaggtggact
      661 tcacctcgtg cacaggcctc ttctgtgtcc tgggaattgt gctcctggtg actgggattg
      721 tcactagcat tgtgctctac ttccaatacg tttactggct ccacatgctc tatgctgctc
      781 tgggggccat ttgtttcacc ctgttcctgg cttacgacac acagctggtc ctggggaacc
      841 ggaagcacac catcagcccc gaggactaca tcactggcgc cctgcagatt tacacagaca
      901 tcatctacat cttcaccttt gtgctgcagc tgatggggga tcgcaattaa ggagcaagcc
      961 cccattttca cccgatcctg ggctctccct tcc
//