LOCUS AK300597 993 bp mRNA linear HUM 31-JUL-2008 DEFINITION Homo sapiens cDNA FLJ53658 complete cds, highly similar to Transmembrane BAX inhibitor motif-containing protein 1. ACCESSION AK300597 VERSION AK300597.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 993) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..993 /cell_type="pulmonary artery endothelial cells (HPAEC)" /clone="PUAEN2002805" /clone_lib="PUAEN2" /db_xref="H-InvDB:HIT000495221" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="primary culture, pulmonary artery endothelial cells" /organism="Homo sapiens" CDS 80..727 /codon_start=1 /note="highly similar to Transmembrane BAX inhibitor motif-containing protein 1" /protein_id="BAG62294.1" /transl_table=1 /translation="MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQ PGYGHPAGYPQPMPPTHPMPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKG TCQRLCEEKCGCLLRVLCCLRCHLPDPCLLPGTQTPFPMEHHSADPFYFCHGLHDGHH FQYVPNQSRHHCNDHHCGGIHFSHHLLLSDQGGLHLVHRPLLCPGNCAPGDWDCH" BASE COUNT 194 a 325 c 243 g 231 t ORIGIN 1 actccgaggc caggaacgct ccgtctggaa cggcgcaggt cccagcagct ggggtttccc 61 cctcagcccg tgagcagcca tgtccaaccc cagcgcccca ccaccatatg aagaccgcaa 121 ccccctgtac ccaggccctc cgccccctgg gggctatggg cagccatctg tcctgccagg 181 agggtatcct gcctaccctg gctacccaca gcctggctac ggtcaccctg ctggctaccc 241 acagcccatg ccccccaccc acccgatgcc catgaactac ggcccaggcc atggctatga 301 tggggaggag agagcggtga gtgatagctt cgggcctgga gagtgggatg accggaaagt 361 gcgacacact tttatccgaa agggaacctg tcagcgcctt tgtgaggaga aatgtggctg 421 tctactacgt gtcctatgct gtcttcgttg tcacctacct gatccttgcc tgctgccagg 481 gacccagacg ccgtttccca tggaacatca ttctgctgac cctttttact tttgccatgg 541 gcttcatgac gggcaccatt tccagtatgt accaaaccaa agccgtcatc attgcaatga 601 tcatcactgc ggtggtatcc atttcagtca ccatcttctg ctttcagacc aaggtggact 661 tcacctcgtg cacaggcctc ttctgtgtcc tgggaattgt gctcctggtg actgggattg 721 tcactagcat tgtgctctac ttccaatacg tttactggct ccacatgctc tatgctgctc 781 tgggggccat ttgtttcacc ctgttcctgg cttacgacac acagctggtc ctggggaacc 841 ggaagcacac catcagcccc gaggactaca tcactggcgc cctgcagatt tacacagaca 901 tcatctacat cttcaccttt gtgctgcagc tgatggggga tcgcaattaa ggagcaagcc 961 cccattttca cccgatcctg ggctctccct tcc //