LOCUS AK300089 1230 bp mRNA linear HUM 31-JUL-2008
DEFINITION Homo sapiens cDNA FLJ61164 complete cds, highly similar to T-cell
surface glycoprotein CD8 alpha chain precursor.
ACCESSION AK300089
VERSION AK300089.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1230)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..1230
/clone="PERIC2006538"
/clone_lib="PERIC2"
/db_xref="H-InvDB:HIT000494713"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="pericardium"
CDS 319..1149
/codon_start=1
/note="highly similar to T-cell surface glycoprotein CD8
alpha chain precursor"
/protein_id="BAG61892.1"
/transl_table=1
/translation="MRNQAPGRPKGATFPPRRPTGSRAPPLAPELRAKQRPGERVMAL
PVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPR
GAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALS
NSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGL
DFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV
"
BASE COUNT 224 a 415 c 353 g 238 t
ORIGIN
1 gaatttccat ccagcaatgc aggccatggg aggctgcagc agtgacgctg tcagatcccc
61 tttgtgagaa taataatttt tataacaacg tggctggagg actgatcagg agagagactg
121 gtgtgaattg aaggctgttg caatggctcc aagaagagat gaggctgtgt gttttcagct
181 gcccccagtt gcctggccag gctgcctcga cggccctatt cacgggcccc agcctcctcg
241 ccgggctgga aggcgacaac cgcgaaaagg agggtgactc tcctcggcgg gggcttcggg
301 tgacatcaca tcctccaaat gcgaaatcag gctccgggcc ggccgaaggg cgcaactttc
361 ccccctcggc gccccaccgg ctcccgcgcg cctcccctcg cgcccgagct tcgagccaag
421 cagcgtcctg gggagcgcgt catggcctta ccagtgaccg ccttgctcct gccgctggcc
481 ttgctgctcc acgccgccag gccgagccag ttccgggtgt cgccgctgga tcggacctgg
541 aacctgggcg agacagtgga gctgaagtgc caggtgctgc tgtccaaccc gacgtcgggc
601 tgctcgtggc tcttccagcc gcgcggcgcc gccgccagtc ccaccttcct cctatacctc
661 tcccaaaaca agcccaaggc ggccgagggg ctggacaccc agcggttctc gggcaagagg
721 ttgggggaca ccttcgtcct caccctgagc gacttccgcc gagagaacga gggctactat
781 ttctgctcgg ccctgagcaa ctccatcatg tacttcagcc acttcgtgcc ggtcttcctg
841 ccagcgaagc ccaccacgac gccagcgccg cgaccaccaa caccggcgcc caccatcgcg
901 tcgcagcccc tgtccctgcg cccagaggcg tgccggccag cggcgggggg cgcagtgcac
961 acgagggggc tggacttcgc ctgtgatatc tacatctggg cgcccttggc cgggacttgt
1021 ggggtccttc tcctgtcact ggttatcacc ctttactgca accacaggaa ccgaagacgt
1081 gtttgcaaat gtccccggcc tgtggtcaaa tcgggagaca agcccagcct ttcggcgaga
1141 tacgtctaac cctgtgcaac agccactaca ttacttcaaa ctgagatcct tccttttgag
1201 ggagcaagtc cttccctttc attttttcca
//