LOCUS       AK298222                1139 bp    mRNA    linear   HUM 24-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ56357 complete cds, highly similar to Homo
            sapiens apolipoprotein A-I binding protein (APOA1BP), mRNA.
ACCESSION   AK298222
VERSION     AK298222.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1139)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..1139
                     /cell_line="IMR32"
                     /cell_type="neuroblastoma"
                     /clone="IMR322017433"
                     /clone_lib="IMR322"
                     /db_xref="H-InvDB:HIT000492846"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
     CDS             3..926
                     /codon_start=1
                     /note="highly similar to Homo sapiens apolipoprotein A-I
                     binding protein (APOA1BP), mRNA"
                     /protein_id="BAG60492.1"
                     /transl_table=1
                     /translation="MRRGRAGPGRAGGARSASWMSRLRALLGLGLLVAGSRLPRIKSQ
                     TIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQL
                     MELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIY
                     YPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREP
                     FHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHY
                     LGGRFVPPALEKKYQLNLPPYPDTECVYRLQ"
BASE COUNT          243 a          318 c          344 g          234 t
ORIGIN      
        1 acatgcgccg gggccgggcc gggccgggcc gggccggggg cgcgcgctct gcgagctgga
       61 tgtccaggct gcgggcgctg ctgggcctcg ggctgctggt tgcgggctcg cgcctgccgc
      121 ggatcaaaag ccagaccatc gcctgtcgct cgggacccac ctggtgggga ccgcagcggc
      181 tgaactcggg tggccgctgg gactcagagg tcatggcgag cacggtggtg aagtacctga
      241 gccaggagga ggcccaggcc gtggaccagg agctatttaa cgaataccag ttcagcgtgg
      301 accaacttat ggaactggcc gggctgagct gtgctacagc catcgccaag gcatatcccc
      361 ccacgtccat gtccaggagc ccccctactg tcctggtcat ctgtggcccg gggaataatg
      421 gaggagatgg tctggtctgt gctcgacacc tcaaactctt tggctacgag ccaaccatct
      481 attaccccaa aaggcctaac aagcccctct tcactgcatt ggtgacccag tgtcagaaaa
      541 tggacatccc tttccttggg gaaatgcccg cagagcccat gacgattgat gaactgtatg
      601 agctggtggt ggatgccatc tttggcttca gcttcaaggg cgatgttcgg gaaccgttcc
      661 acagcatcct gagtgtcctg aagggactca ctgtgcccat tgccagcatc gacattccct
      721 caggatggga cgtggagaag ggaaatgctg gagggatcca gccagacttg ctcatctccc
      781 tcacagcccc caaaaaatct gcaacccagt ttaccggtcg ctaccattac ctggggggtc
      841 gttttgtgcc acctgctctg gaaaagaagt accagctgaa cctgccaccc taccctgaca
      901 ctgagtgtgt ctatcgtctg cagtgaggga aggtgggtgg gtattctccc caataaagac
      961 ttagagcccc tctcttccag aactgtggat tcctgggagc tcctctggca ataaaagtca
     1021 gtgaatggtg gaagtcagag agcaaccctg gggattgggt gccatctctc taggggtaac
     1081 acaaagggca agaggttgct atggtatttg gaaacaatga aaatggactg ttagatgcc
//