LOCUS AK298222 1139 bp mRNA linear HUM 24-JUL-2008 DEFINITION Homo sapiens cDNA FLJ56357 complete cds, highly similar to Homo sapiens apolipoprotein A-I binding protein (APOA1BP), mRNA. ACCESSION AK298222 VERSION AK298222.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1139) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..1139 /cell_line="IMR32" /cell_type="neuroblastoma" /clone="IMR322017433" /clone_lib="IMR322" /db_xref="H-InvDB:HIT000492846" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" CDS 3..926 /codon_start=1 /note="highly similar to Homo sapiens apolipoprotein A-I binding protein (APOA1BP), mRNA" /protein_id="BAG60492.1" /transl_table=1 /translation="MRRGRAGPGRAGGARSASWMSRLRALLGLGLLVAGSRLPRIKSQ TIACRSGPTWWGPQRLNSGGRWDSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQL MELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIY YPKRPNKPLFTALVTQCQKMDIPFLGEMPAEPMTIDELYELVVDAIFGFSFKGDVREP FHSILSVLKGLTVPIASIDIPSGWDVEKGNAGGIQPDLLISLTAPKKSATQFTGRYHY LGGRFVPPALEKKYQLNLPPYPDTECVYRLQ" BASE COUNT 243 a 318 c 344 g 234 t ORIGIN 1 acatgcgccg gggccgggcc gggccgggcc gggccggggg cgcgcgctct gcgagctgga 61 tgtccaggct gcgggcgctg ctgggcctcg ggctgctggt tgcgggctcg cgcctgccgc 121 ggatcaaaag ccagaccatc gcctgtcgct cgggacccac ctggtgggga ccgcagcggc 181 tgaactcggg tggccgctgg gactcagagg tcatggcgag cacggtggtg aagtacctga 241 gccaggagga ggcccaggcc gtggaccagg agctatttaa cgaataccag ttcagcgtgg 301 accaacttat ggaactggcc gggctgagct gtgctacagc catcgccaag gcatatcccc 361 ccacgtccat gtccaggagc ccccctactg tcctggtcat ctgtggcccg gggaataatg 421 gaggagatgg tctggtctgt gctcgacacc tcaaactctt tggctacgag ccaaccatct 481 attaccccaa aaggcctaac aagcccctct tcactgcatt ggtgacccag tgtcagaaaa 541 tggacatccc tttccttggg gaaatgcccg cagagcccat gacgattgat gaactgtatg 601 agctggtggt ggatgccatc tttggcttca gcttcaaggg cgatgttcgg gaaccgttcc 661 acagcatcct gagtgtcctg aagggactca ctgtgcccat tgccagcatc gacattccct 721 caggatggga cgtggagaag ggaaatgctg gagggatcca gccagacttg ctcatctccc 781 tcacagcccc caaaaaatct gcaacccagt ttaccggtcg ctaccattac ctggggggtc 841 gttttgtgcc acctgctctg gaaaagaagt accagctgaa cctgccaccc taccctgaca 901 ctgagtgtgt ctatcgtctg cagtgaggga aggtgggtgg gtattctccc caataaagac 961 ttagagcccc tctcttccag aactgtggat tcctgggagc tcctctggca ataaaagtca 1021 gtgaatggtg gaagtcagag agcaaccctg gggattgggt gccatctctc taggggtaac 1081 acaaagggca agaggttgct atggtatttg gaaacaatga aaatggactg ttagatgcc //