LOCUS AK298123 1037 bp mRNA linear HUM 31-JUL-2008 DEFINITION Homo sapiens cDNA FLJ53633 complete cds, highly similar to Transmembrane BAX inhibitor motif-containing protein 1. ACCESSION AK298123 VERSION AK298123.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1037) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..1037 /clone="HLUNG2018958" /clone_lib="HLUNG2" /db_xref="H-InvDB:HIT000492747" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /organism="Homo sapiens" /tissue_type="lung" CDS 111..860 /codon_start=1 /note="highly similar to Transmembrane BAX inhibitor motif-containing protein 1" /protein_id="BAG60403.1" /transl_table=1 /translation="MPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSII SVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWN IILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGL FCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTI SPEDYITGALQIYTDIIYIFTFVLQLMGDRN" BASE COUNT 198 a 312 c 256 g 271 t ORIGIN 1 aacactccga ggccaggaac gctccgtctg gaacggcgca ggtcccagca gctggggttc 61 cccctcagcc cgtgagcagc catgtccaac cccagcgccc cacccacccg atgcccatga 121 actacggccc aggccatggc tatgatgggg aggagagagc agtgagtgat agcttcgggc 181 ctggagagtg ggatgaccgg aaagtgcgac acacttttat ccgaaaggtt tactccatca 241 tctccgtgca gctgctcatc actgtggcca tcattgctat cttcaccttt gtggaacctg 301 tcagcgcctt tgtgaggaga aatgtggctg tctactacgt gtcctatgct gtcttcgttg 361 tcacctacct gatccttgcc tgctgccagg gacccagacg ccgtttccca tggaacatca 421 ttctgctgac cctttttact tttgccatgg gcttcatgac gggcaccatt tccagtatgt 481 accaaaccaa agccgtcatc attgcaatga tcatcactgc ggtggtatcc atttcagtca 541 ccatcttctg ctttcagacc aaggtggact tcacctcgtg cacaggcctc ttctgtgtcc 601 tgggaattgt gctcctggtg actgggattg tcactagcat tgtgctctac ttccaatacg 661 tttactggct ccacatgctc tatgctgctc tgggggccat ttgtttcacc ctgttcctgg 721 cttacgacac acagctggtc ctggggaacc ggaagcacac catcagcccc gaggactaca 781 tcactggcgc cctgcagatt tacacagaca tcatctacat cttcaccttt gtgctgcagc 841 tgatggggga tcgcaattaa ggagcaagcc cccattttca cccgatcctg ggctctccct 901 tccaagctag agggctgggc cctatgactg tggtctgggc tttaggcccc tttccttccc 961 cttgagtaac atgcccagtt tcctttctgt cctggagaca ggtggcctct ctggctatgg 1021 atgtgtgggt acttggt //