LOCUS       AK298123                1037 bp    mRNA    linear   HUM 31-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ53633 complete cds, highly similar to
            Transmembrane BAX inhibitor motif-containing protein 1.
ACCESSION   AK298123
VERSION     AK298123.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1037)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..1037
                     /clone="HLUNG2018958"
                     /clone_lib="HLUNG2"
                     /db_xref="H-InvDB:HIT000492747"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /organism="Homo sapiens"
                     /tissue_type="lung"
     CDS             111..860
                     /codon_start=1
                     /note="highly similar to Transmembrane BAX inhibitor
                     motif-containing protein 1"
                     /protein_id="BAG60403.1"
                     /transl_table=1
                     /translation="MPMNYGPGHGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSII
                     SVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVSYAVFVVTYLILACCQGPRRRFPWN
                     IILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGL
                     FCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTI
                     SPEDYITGALQIYTDIIYIFTFVLQLMGDRN"
BASE COUNT          198 a          312 c          256 g          271 t
ORIGIN      
        1 aacactccga ggccaggaac gctccgtctg gaacggcgca ggtcccagca gctggggttc
       61 cccctcagcc cgtgagcagc catgtccaac cccagcgccc cacccacccg atgcccatga
      121 actacggccc aggccatggc tatgatgggg aggagagagc agtgagtgat agcttcgggc
      181 ctggagagtg ggatgaccgg aaagtgcgac acacttttat ccgaaaggtt tactccatca
      241 tctccgtgca gctgctcatc actgtggcca tcattgctat cttcaccttt gtggaacctg
      301 tcagcgcctt tgtgaggaga aatgtggctg tctactacgt gtcctatgct gtcttcgttg
      361 tcacctacct gatccttgcc tgctgccagg gacccagacg ccgtttccca tggaacatca
      421 ttctgctgac cctttttact tttgccatgg gcttcatgac gggcaccatt tccagtatgt
      481 accaaaccaa agccgtcatc attgcaatga tcatcactgc ggtggtatcc atttcagtca
      541 ccatcttctg ctttcagacc aaggtggact tcacctcgtg cacaggcctc ttctgtgtcc
      601 tgggaattgt gctcctggtg actgggattg tcactagcat tgtgctctac ttccaatacg
      661 tttactggct ccacatgctc tatgctgctc tgggggccat ttgtttcacc ctgttcctgg
      721 cttacgacac acagctggtc ctggggaacc ggaagcacac catcagcccc gaggactaca
      781 tcactggcgc cctgcagatt tacacagaca tcatctacat cttcaccttt gtgctgcagc
      841 tgatggggga tcgcaattaa ggagcaagcc cccattttca cccgatcctg ggctctccct
      901 tccaagctag agggctgggc cctatgactg tggtctgggc tttaggcccc tttccttccc
      961 cttgagtaac atgcccagtt tcctttctgt cctggagaca ggtggcctct ctggctatgg
     1021 atgtgtgggt acttggt
//