LOCUS AK297990 985 bp mRNA linear HUM 24-JUL-2008
DEFINITION Homo sapiens cDNA FLJ52003 complete cds, highly similar to Homo
sapiens nucleoredoxin (NXN), mRNA.
ACCESSION AK297990
VERSION AK297990.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 985)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..985
/clone="HLUNG2000237"
/clone_lib="HLUNG2"
/db_xref="H-InvDB:HIT000492614"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="lung"
CDS 137..517
/codon_start=1
/note="highly similar to Homo sapiens nucleoredoxin
(NXN), mRNA"
/protein_id="BAG60298.1"
/transl_table=1
/translation="MPWLAVPYTDEARRSRLNRLYGIQDSEDDGESEAAKQLIQPIAE
KIIAKYKAKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVE
EITPAIVEAFVNDFLAEKLKPEPI"
BASE COUNT 195 a 299 c 301 g 190 t
ORIGIN
1 gtgtccgccc tgccgaagcc tcacccgggt cctggtggaa tcctaccgga agatcaagga
61 ggcaggccag aacttcgaga tcatcttcgt tagtgcagac aggtcggagg agtccttcaa
121 acagtacttc agtgagatgc cctggctcgc cgtcccctac acggatgagg cccggcggtc
181 gcgcctcaac cggctgtacg gaatccaaga ttctgaggat gacggagagt ccgaggcggc
241 caagcagctg attcagccga tagctgagaa aatcattgcc aagtacaaag ccaaagagga
301 ggaggcaccc cttctgttct tcgtagccgg ggaggatgac atgactgact ccctgcgaga
361 ttacaccaac ctgcctgagg ctgccccttt gctcaccatc ctggacatgt cagcccgggc
421 caagtacgtg atggacgtgg aggagatcac ccccgccatc gtggaggcct ttgtgaatga
481 cttcctagca gagaagctca aaccggagcc catctagcgt ggctccggcc tcctgagacg
541 ttatttaaaa ctcagccttc tcctcctccc cctccttcct tccgcccttg gacttaccca
601 gcgtgccccg aatcccacca cccaagtgtc cagcctctct gtggtgcctt gtttctgcag
661 taacctcctc agccagcacc ctggggtgcg gaatcagcag cggcagagtc caccgtgttt
721 ggagactctg tttgggagca cgggatggcc gggggcccgg ccagagcggg gctgcatggc
781 tttcgcaaag tcactagctt ttggtgaagg atctgccagg gtgtcctggg cagagtgagc
841 gtggagggcc ggtgggtccc gctcgggctc tgactctgac gtcggcacac acggccccgg
901 acggccagag gggaaccgcc gggtgacacc tgcgtggagg ctgagctgag aaagggcctc
961 cgcttagagc tgcgggtgag gacgt
//