LOCUS AK296890 672 bp mRNA linear HUM 24-JUL-2008 DEFINITION Homo sapiens cDNA FLJ52243 complete cds, highly similar to Heat-shock protein beta-1. ACCESSION AK296890 VERSION AK296890.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 672) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..672 /clone="CTONG2025177" /clone_lib="CTONG2" /db_xref="H-InvDB:HIT000491514" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="tumor tissue" /organism="Homo sapiens" /tissue_type="tongue, tumor tissue" CDS 41..553 /codon_start=1 /note="highly similar to Heat-shock protein beta-1" /protein_id="BAG59449.1" /transl_table=1 /translation="MTERRVPFSLLRGPSWPGYVRPLPPAAIESPAVAAPAYSRALSR QLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRC FTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPE AAKSDETAAK" BASE COUNT 126 a 251 c 182 g 113 t ORIGIN 1 gcacttttct gagcagacgt ccagagcaga gtcagccagc atgaccgagc gccgcgtccc 61 cttctcgctc ctgcggggcc ccagctggcc aggctacgtg cgccccctgc cccccgccgc 121 catcgagagc cccgcagtgg ccgcgcccgc ctacagccgc gcgctcagcc ggcaactcag 181 cagcggggtc tcggagatcc ggcacactgc ggaccgctgg cgcgtgtccc tggatgtcaa 241 ccacttcgcc ccggacgagc tgacggtcaa gaccaaggat ggcgtggtgg agatcaccgg 301 caagcacgag gagcggcagg acgagcatgg ctacatctcc cggtgcttca cgcggaaata 361 cacgctgccc cccggtgtgg accccaccca agtttcctcc tccctgtccc ctgagggcac 421 actgaccgtg gaggccccca tgcccaagct agccacgcag tccaacgaga tcaccatccc 481 agtcaccttc gagtcgcggg cccagcttgg gggcccagaa gctgcaaaat ccgatgagac 541 tgccgccaag taaagcctta gcccggatgc ccacccctgc tgccgccact ggctgtgcct 601 cccccgccac ctgtgtgttc ttttgataca tttatcttct gtttttctca aataaagttc 661 aaagcaacca cc //