LOCUS       AK296890                 672 bp    mRNA    linear   HUM 24-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ52243 complete cds, highly similar to
            Heat-shock protein beta-1.
ACCESSION   AK296890
VERSION     AK296890.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 672)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..672
                     /clone="CTONG2025177"
                     /clone_lib="CTONG2"
                     /db_xref="H-InvDB:HIT000491514"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="tumor tissue"
                     /organism="Homo sapiens"
                     /tissue_type="tongue, tumor tissue"
     CDS             41..553
                     /codon_start=1
                     /note="highly similar to Heat-shock protein beta-1"
                     /protein_id="BAG59449.1"
                     /transl_table=1
                     /translation="MTERRVPFSLLRGPSWPGYVRPLPPAAIESPAVAAPAYSRALSR
                     QLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRC
                     FTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPE
                     AAKSDETAAK"
BASE COUNT          126 a          251 c          182 g          113 t
ORIGIN      
        1 gcacttttct gagcagacgt ccagagcaga gtcagccagc atgaccgagc gccgcgtccc
       61 cttctcgctc ctgcggggcc ccagctggcc aggctacgtg cgccccctgc cccccgccgc
      121 catcgagagc cccgcagtgg ccgcgcccgc ctacagccgc gcgctcagcc ggcaactcag
      181 cagcggggtc tcggagatcc ggcacactgc ggaccgctgg cgcgtgtccc tggatgtcaa
      241 ccacttcgcc ccggacgagc tgacggtcaa gaccaaggat ggcgtggtgg agatcaccgg
      301 caagcacgag gagcggcagg acgagcatgg ctacatctcc cggtgcttca cgcggaaata
      361 cacgctgccc cccggtgtgg accccaccca agtttcctcc tccctgtccc ctgagggcac
      421 actgaccgtg gaggccccca tgcccaagct agccacgcag tccaacgaga tcaccatccc
      481 agtcaccttc gagtcgcggg cccagcttgg gggcccagaa gctgcaaaat ccgatgagac
      541 tgccgccaag taaagcctta gcccggatgc ccacccctgc tgccgccact ggctgtgcct
      601 cccccgccac ctgtgtgttc ttttgataca tttatcttct gtttttctca aataaagttc
      661 aaagcaacca cc
//