LOCUS AK296686 945 bp mRNA linear HUM 31-JUL-2008 DEFINITION Homo sapiens cDNA FLJ53800 complete cds, highly similar to Aldo-keto reductase family 1 member C2 (EC 1.-.-.-). ACCESSION AK296686 VERSION AK296686.1 KEYWORDS FLI_CDNA; oligo capping. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 945) AUTHORS Isogai,T. and Yamamoto,J. TITLE Direct Submission JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases. Contact:Takao Isogai Reverse Proteomics Research Institute; 1-9-11 Kaji-cho, Chiyoda-ku, Tokyo 101-0044, Japan E-mail :flj-cdna@nifty.com REFERENCE 2 AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K., Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y., Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M., Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T. TITLE NEDO human cDNA sequencing project focused on splicing variants JOURNAL Unpublished (2007) COMMENT Human cDNA sequencing project focused on splicing variants of mRNA in NEDO functional analysis of protein and research application project supported by Ministry of Economy, Trade and Industry, Japan; cDNA selection for complete cds sequencing: Reverse Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan (Hitachi) and Japan Biological Informatics Consortium, Japan (JBIC); cDNA complete cds sequencing: JBIC; cDNA library construction: Helix Research Institute supported by Japan Key Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing: Research Association for Biotechnology, Japan, Biotechnology Center, National Institute of Technology and Evaluation, Japan and HRI; cDNA mapping to human genome: Central Research Laboratory, Hitachi; evaluation and annotation: REPRORI. FEATURES Location/Qualifiers source 1..945 /clone="CTONG2001229" /clone_lib="CTONG2" /db_xref="H-InvDB:HIT000491310" /db_xref="taxon:9606" /mol_type="mRNA" /note="cloning vector: pME18SFL3" /note="tumor tissue" /organism="Homo sapiens" /tissue_type="tongue, tumor tissue" CDS 27..446 /codon_start=1 /note="highly similar to Aldo-keto reductase family 1 member C2 (EC 1.-.-.-)" /protein_id="BAG59281.1" /transl_table=1 /translation="MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEA GFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERS LKNLQLDYVDLYLIHFPVSVKEDIGILTWKKSPKHNS" BASE COUNT 279 a 194 c 204 g 268 t ORIGIN 1 atttgctaac caggccagtg acagaaatgg attcgaaata ccagtgtgtg aagctgaatg 61 atggtcactt catgcctgtc ctgggatttg gcacctatgc gcctgcagag gttcctaaaa 121 gtaaagctct agaggccgtc aaattggcaa tagaagccgg gttccaccat attgattctg 181 cacatgttta caataatgag gagcaggttg gactggccat ccgaagcaag attgcagatg 241 gcagtgtgaa gagagaagac atattctaca cttcaaagct ttggagcaat tcccatcgac 301 cagagttggt ccgaccagcc ttggaaaggt cactgaaaaa tcttcaattg gactatgttg 361 acctctatct tattcatttt ccagtgtctg taaaggagga catagggatt ttaacatgga 421 agaagagccc taaacataac tcctaattcc tttctatgga acagaaagca attttgaatc 481 catacttccg tgattgcatg tctacaagaa aagagagtgc agaatcctca aagcctctgc 541 ctcaaaaact tgaggaaatg acaatcatct ccttgaaggc acaaggtctt atttatgatt 601 cctgatttca cctcttggga tgttcacaga cacagagttt catgaagctg tggtgtccag 661 aaaacctgct gcacataggg tgcacaatga gtttccatct tcttgcctct tttcaagggg 721 caagaactca gtccgggaat gtcttaaact acaaaccttc atgggaaacc ttgttgcttc 781 tgcttcctct cttttcacac tggaggtttt atttttgctt agccatgaat tcttgtgtca 841 ttcataactt ttgtcttaag gtactgaaaa ctagtcaggc tagttaatgc aaaagggtat 901 attagatatg ataatgggaa atcaaagcca gggctacatt aagaa //