LOCUS       AK296686                 945 bp    mRNA    linear   HUM 31-JUL-2008
DEFINITION  Homo sapiens cDNA FLJ53800 complete cds, highly similar to
            Aldo-keto reductase family 1 member C2 (EC 1.-.-.-).
ACCESSION   AK296686
VERSION     AK296686.1
KEYWORDS    FLI_CDNA; oligo capping.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 945)
  AUTHORS   Isogai,T. and Yamamoto,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
            Contact:Takao Isogai
            Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
            Chiyoda-ku, Tokyo 101-0044, Japan
            E-mail :flj-cdna@nifty.com
REFERENCE   2
  AUTHORS   Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
            Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
            Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
            Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
  TITLE     NEDO human cDNA sequencing project focused on splicing variants
  JOURNAL   Unpublished (2007)
COMMENT     Human cDNA sequencing project focused on splicing variants of mRNA
            in NEDO functional analysis of protein and research application
            project supported by Ministry of Economy, Trade and Industry,
            Japan; cDNA selection for complete cds sequencing: Reverse
            Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
            (Hitachi) and Japan Biological Informatics Consortium, Japan
            (JBIC); cDNA complete cds sequencing: JBIC; cDNA library
            construction: Helix Research Institute supported by Japan Key
            Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
            Research Association for Biotechnology, Japan, Biotechnology
            Center, National Institute of Technology and Evaluation, Japan and
            HRI; cDNA mapping to human genome: Central Research Laboratory,
            Hitachi; evaluation and annotation: REPRORI.
FEATURES             Location/Qualifiers
     source          1..945
                     /clone="CTONG2001229"
                     /clone_lib="CTONG2"
                     /db_xref="H-InvDB:HIT000491310"
                     /db_xref="taxon:9606"
                     /mol_type="mRNA"
                     /note="cloning vector: pME18SFL3"
                     /note="tumor tissue"
                     /organism="Homo sapiens"
                     /tissue_type="tongue, tumor tissue"
     CDS             27..446
                     /codon_start=1
                     /note="highly similar to Aldo-keto reductase family 1
                     member C2 (EC 1.-.-.-)"
                     /protein_id="BAG59281.1"
                     /transl_table=1
                     /translation="MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEA
                     GFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERS
                     LKNLQLDYVDLYLIHFPVSVKEDIGILTWKKSPKHNS"
BASE COUNT          279 a          194 c          204 g          268 t
ORIGIN      
        1 atttgctaac caggccagtg acagaaatgg attcgaaata ccagtgtgtg aagctgaatg
       61 atggtcactt catgcctgtc ctgggatttg gcacctatgc gcctgcagag gttcctaaaa
      121 gtaaagctct agaggccgtc aaattggcaa tagaagccgg gttccaccat attgattctg
      181 cacatgttta caataatgag gagcaggttg gactggccat ccgaagcaag attgcagatg
      241 gcagtgtgaa gagagaagac atattctaca cttcaaagct ttggagcaat tcccatcgac
      301 cagagttggt ccgaccagcc ttggaaaggt cactgaaaaa tcttcaattg gactatgttg
      361 acctctatct tattcatttt ccagtgtctg taaaggagga catagggatt ttaacatgga
      421 agaagagccc taaacataac tcctaattcc tttctatgga acagaaagca attttgaatc
      481 catacttccg tgattgcatg tctacaagaa aagagagtgc agaatcctca aagcctctgc
      541 ctcaaaaact tgaggaaatg acaatcatct ccttgaaggc acaaggtctt atttatgatt
      601 cctgatttca cctcttggga tgttcacaga cacagagttt catgaagctg tggtgtccag
      661 aaaacctgct gcacataggg tgcacaatga gtttccatct tcttgcctct tttcaagggg
      721 caagaactca gtccgggaat gtcttaaact acaaaccttc atgggaaacc ttgttgcttc
      781 tgcttcctct cttttcacac tggaggtttt atttttgctt agccatgaat tcttgtgtca
      841 ttcataactt ttgtcttaag gtactgaaaa ctagtcaggc tagttaatgc aaaagggtat
      901 attagatatg ataatgggaa atcaaagcca gggctacatt aagaa
//