LOCUS AK296630 793 bp mRNA linear HUM 21-JAN-2009
DEFINITION Homo sapiens cDNA FLJ50559 complete cds, highly similar to
Phosphomannomutase 2 (EC 5.4.2.8).
ACCESSION AK296630
VERSION AK296630.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 793)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..793
/clone="COLON2005239"
/clone_lib="COLON2"
/db_xref="H-InvDB:HIT000491254"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="colon"
CDS 223..588
/codon_start=1
/note="highly similar to Phosphomannomutase 2 (EC
5.4.2.8)"
/protein_id="BAH12405.1"
/transl_table=1
/translation="MLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKG
LTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTM
GYSVTAPEDTRRICELLFS"
BASE COUNT 223 a 189 c 220 g 161 t
ORIGIN
1 gctagaaact ggggacatgg cagcgcctgg cccagcgctc tgcctcttcg acgtggatgg
61 gaccctcacc gccccgcggc agaaaattac caaagaaatg gatgacttcc tacaaaaatt
121 gaggcagaag atcaaaatcg gagtggtagg cggatcggac tttgagaaag tgcaggagca
181 actgggaaat gatggggtac tttcattgaa ttccgaaatg ggatgttaaa cgtgtcccct
241 attggaagaa gctgcagcca agaagaacgc attgagttct acgaactcga taaaaaagaa
301 aatataagac aaaagtttgt agcagatcta cggaaagagt ttgctggaaa aggcctcacg
361 ttttccatag gaggccagat cagctttgat gtctttcctg atggatggga caagagatac
421 tgtctgcgac atgtggaaaa tgacggttat aagaccattt atttctttgg agacaaaact
481 atgccaggtg gcaatgacca tgagatcttc acagacccca gaaccatggg ctactccgtg
541 acagcgcctg aggacacgcg caggatctgt gaactgctgt tctcctaacg tgggagcggg
601 aggggcgggg tcccggctga caagccagca tagggcattc ggtggccaga gccgagggtc
661 ctcccacacg tgctcaccca cccccagcct aggcaggctc tgcatgctat gccaggcatg
721 tgcagtctgg acttccacct ccagtgccag aaacttccag aaggaaggag aaaactcttg
781 tcaagaatgg ccc
//