LOCUS AK295591 1052 bp mRNA linear HUM 21-JAN-2009
DEFINITION Homo sapiens cDNA FLJ55066 complete cds, highly similar to
LAS1-like protein.
ACCESSION AK295591
VERSION AK295591.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1052)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..1052
/clone="BRHIP2026458"
/clone_lib="BRHIP2"
/db_xref="H-InvDB:HIT000490215"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="hippocampus"
CDS 42..635
/codon_start=1
/note="highly similar to LAS1-like protein"
/protein_id="BAH12117.1"
/transl_table=1
/translation="MSWESGAGPGLGSQGMDLVWSAWYGKCVKGKGSLPLSAHGIVVA
WLSRAEWDQVTVYLFCDDHKLQRYALNRITVWRSRSGNELPLAVASTADLIRCKLLDV
TGGLGTDELRLLYGMALVRFVNLISERKTKFAKVPLKCLALSGRNARRFSAGQWEARR
GWRLFNCSASLDWPRMVESCLGSPCWASPQLLRIPGS"
BASE COUNT 206 a 311 c 292 g 243 t
ORIGIN
1 gtgcggagcg gcgcggcaca gagcctgttg ttgagctcag tatgtcgtgg gaatccgggg
61 ccgggccagg tctaggttcc caggggatgg atctcgtgtg gagtgcgtgg tacggaaagt
121 gcgttaaagg gaaagggtcg ttgccactct cggcccacgg catcgtggtc gcctggctca
181 gcagggccga gtgggaccag gtgacggttt atctgttctg tgacgaccat aagttgcagc
241 ggtacgcgct taaccgcatc acggtgtgga ggagcaggtc aggcaacgaa ctccctctgg
301 cagtggcttc tactgctgac ctgatacgct gtaagctctt ggatgtaact ggtggcttgg
361 gcactgatga acttagactg ctctatggca tggcattggt caggtttgtg aatcttatct
421 cagagaggaa gacaaagttt gccaaggtcc ccctcaagtg tctggctctc tcaggacgga
481 atgctcgccg attttctgca ggccagtggg aagcaagaag gggctggagg ctgttcaact
541 gctccgcctc ccttgactgg ccccggatgg ttgagtcctg cttgggctca ccttgctggg
601 ccagccccca actccttcgg atcccgggta gctgagctct gctggagaaa accacatagc
661 cctgcggatt gctgccactg cagagcttcc tcgagcacat ggaggcatcc ggcagggccc
721 cctcgacctg aggtccagcc ctcgtgaact gatctgcggc tgcactcaac cttctcgcca
781 gtctcaggat gaggtggcct tgccccacct caaagcctgc tcctccacct gtgctctgga
841 gccacctctg ccagcatcgc tggggcctca ccccagcctc taccttgctc tgctggctct
901 tgctcttcaa cctaggaacg tgcctgagct tttctcatct taaacaaaac aacaataaca
961 gcaacacaag caaaatctcc tttgaccctg catccctctg ttgggttatc atcagcttat
1021 cattcccacc cttcccatca aaacatctca aa
//