LOCUS AK294707 1004 bp mRNA linear HUM 31-JUL-2008
DEFINITION Homo sapiens cDNA FLJ53784 complete cds, highly similar to Natural
resistance-associated macrophage protein 1.
ACCESSION AK294707
VERSION AK294707.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1004)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..1004
/clone="BRAWH3001473"
/clone_lib="BRAWH3"
/db_xref="H-InvDB:HIT000489331"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="brain"
CDS 82..573
/codon_start=1
/note="highly similar to Natural resistance-associated
macrophage protein 1"
/protein_id="BAG57862.1"
/transl_table=1
/translation="MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLSEKIP
IPDTKPGTFSLRKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVAGFKLLWVLLWATVL
GLLCQRLAARLGVVTGKDLGEVCHLYYPKSESRSVAQSGVQWCDVSSLQPLPPRCPAP
SSG"
BASE COUNT 194 a 337 c 264 g 209 t
ORIGIN
1 agtgcccaga gagggggtgc aggctgagga gctgcccaga gcaccgctca cactcccaga
61 gtacctgaag tcgccatttc aatgacaggt gacaagggtc cccaaaggct aagcgggtcc
121 agctatggtt ccatctccag cccgaccagc ccgaccagcc cagggccaca gcaagcacct
181 cccagagaga cctacctgag tgagaagatc cccatcccag acacaaaacc gggcaccttc
241 agcctgcgga agctatgggc cttcacgggg cctggcttcc tcatgagcat tgctttcctg
301 gacccaggaa acatcgagtc agatcttcag gctggcgccg tggcgggatt caaacttctc
361 tgggtgctgc tctgggccac cgtgttgggc ttgctctgcc agcgactggc tgcacgtctg
421 ggcgtggtga caggcaagga cttgggcgag gtctgccatc tctactaccc taagtcggag
481 tctcgctccg tcgcccagtc aggagtgcaa tggtgcgatg tcagctcact gcaacctcta
541 cctcccaggt gccccgcacc gtcctctggc tgaccatcga gctagccatt gtgggctccg
601 acatgcagga agtcatcggc acggccattg cattcaatct gctctcagct ggacggtacc
661 accccagtgt accccaactc ttcaggccag gcagagaaca gctgctgcta cttccccccc
721 taaccagtcc ctcccagagt ctattttatc ccgctgtccc ctctgaagca gggctgctgc
781 cctgttttcc agaaatgtaa agtgacttgt ctaaagtcac acagatgtga gtcatgcagg
841 actttgggac tgcagcccca aactccctgc tgcgccgggt gccaggtctc tcctctagct
901 ctgccctgcc tcgactgttc tatgccacac tcccactccc cttgccctag ctgtctgggg
961 gcgcttaggg tcctgctccc aggaggccag attcctgtct ccag
//