LOCUS AK294683 1143 bp mRNA linear HUM 24-JUL-2008
DEFINITION Homo sapiens cDNA FLJ59198 complete cds, highly similar to Homo
sapiens heterogeneous nuclear ribonucleoprotein D-like (HNRPDL),
transcript variant 2, mRNA.
ACCESSION AK294683
VERSION AK294683.1
KEYWORDS FLI_CDNA; oligo capping.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1143)
AUTHORS Isogai,T. and Yamamoto,J.
TITLE Direct Submission
JOURNAL Submitted (09-OCT-2007) to the DDBJ/EMBL/GenBank databases.
Contact:Takao Isogai
Reverse Proteomics Research Institute; 1-9-11 Kaji-cho,
Chiyoda-ku, Tokyo 101-0044, Japan
E-mail :flj-cdna@nifty.com
REFERENCE 2
AUTHORS Wakamatsu,A., Yamamoto,J., Kimura,K., Ishii,S., Watanabe,K.,
Sugiyama,A., Murakawa,K., Kaida,T., Tsuchiya,K., Fukuzumi,Y.,
Kumagai,A., Oishi,Y., Yamamoto,S., Ono,Y., Komori,Y., Yamazaki,M.,
Kisu,Y., Nishikawa,T., Sugano,S., Nomura,N. and Isogai,T.
TITLE NEDO human cDNA sequencing project focused on splicing variants
JOURNAL Unpublished (2007)
COMMENT Human cDNA sequencing project focused on splicing variants of mRNA
in NEDO functional analysis of protein and research application
project supported by Ministry of Economy, Trade and Industry,
Japan; cDNA selection for complete cds sequencing: Reverse
Proteomics Research Institute (REPRORI), Hitachi, Ltd., Japan
(Hitachi) and Japan Biological Informatics Consortium, Japan
(JBIC); cDNA complete cds sequencing: JBIC; cDNA library
construction: Helix Research Institute supported by Japan Key
Technology Center, Japan (HRI); cDNA 5'- & 3'-end sequencing:
Research Association for Biotechnology, Japan, Biotechnology
Center, National Institute of Technology and Evaluation, Japan and
HRI; cDNA mapping to human genome: Central Research Laboratory,
Hitachi; evaluation and annotation: REPRORI.
FEATURES Location/Qualifiers
source 1..1143
/clone="BRAWH2017577"
/clone_lib="BRAWH2"
/db_xref="H-InvDB:HIT000489307"
/db_xref="taxon:9606"
/mol_type="mRNA"
/note="cloning vector: pME18SFL3"
/organism="Homo sapiens"
/tissue_type="brain"
CDS 200..667
/codon_start=1
/note="highly similar to Homo sapiens heterogeneous
nuclear ribonucleoprotein D-like (HNRPDL), transcript
variant 2, mRNA"
/protein_id="BAG57844.1"
/transl_table=1
/translation="MDTKTNERRGFCFITYTDEEPVKKLLESRYHQIGSGKCEIKVAQ
PKEVYRQQQQQQKGGRGAAAGGRGGTRGRGRGQGQNWNQGFNNYYDQGYGNYNSAYGG
DQNYSGYGGYDYTGYNYGNYGYGQGYADYSGQQSTYGKASRGGGNHQNNYQPY"
BASE COUNT 379 a 210 c 268 g 286 t
ORIGIN
1 attttaaatc cagctccata caacgctccg ccgccgctgc tgccgcgacc cggactgcgc
61 gccagcaccc ccctgccgac agctccgtca ctatggagga tatgaacgag tacagcaata
121 tagaggaatt cgcagaggga tccaagatca acgcgagcaa gaatcagcag gatgacggat
181 tgaaaatatt gaacttccca tggatacaaa aacaaatgaa agaagaggat tttgttttat
241 cacatatact gatgaagagc cagtaaaaaa attgttagaa agcagatacc atcaaattgg
301 ttctgggaag tgtgaaatca aagttgcaca acccaaagag gtatataggc agcaacagca
361 acaacaaaaa ggtggaagag gtgctgcagc tggtggacga ggtggtacga ggggtcgtgg
421 ccgaggtcag ggccaaaact ggaaccaagg atttaataac tattatgatc aaggatatgg
481 aaattacaat agtgcctatg gtggtgatca aaactatagt ggctatggcg gatatgatta
541 tactgggtat aactatggga actatggata tggacaggga tatgcagact acagtggcca
601 acagagcact tatggcaagg catctcgagg gggtggcaat caccaaaaca attaccagcc
661 atactaaagg agaacattgg agaaaacagg tgtgtataag agtacaggaa aacagtagaa
721 atgtctaatt taatttaaag atcaatagac aaatgaaacg taaaaacaaa atactatgta
781 gcctgttttt actaaattgt tgatttttta attgctttat gagcctgttt tgcctaaagt
841 gtctatagat ctttaacttt aaagtcttat ctcactttct ttagtattgc agaaaaactt
901 aagagttttt ctgtttgctt ttgtgtacca ggtggtctag aggaataatt aaacatttta
961 gaactattaa caggtaaagt actgaaatgg gtacaactta aggaaaacaa gaatgttgtc
1021 ttctaactct gacattatac cttgtttgta cccgccagcg ggaacttcat tgcaggccgt
1081 gtgtcaccct gaccacgtct atctctgggg gtcgcacgtt gcgggcagag cgcaaggcat
1141 aca
//